Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR552 IGR551 IGR549 IGR550 IGR553 IGR555 IGR558 IGR548 IGR554 IGR547 IGR557 IGR556 IGR546 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 manX, - HD0768 oadB, - HD0782 HD0770 rpL32, - HD0772 HD0778 HD0776 HD0771 HD0777 HD0775 dsrA, - HD0769 fabH, - HD0774 plsX, - HD0773 phnA, - HD0781 yhjA,ccp, - HD0780 ccp, - HD0779 manX, - HD0768 oadB, - HD0782 HD0770 rpL32, - HD0772 HD0778 HD0776 HD0771 HD0777 HD0775 dsrA, - HD0769 fabH, - HD0774 plsX, - HD0773 yhjA,ccp, - HD0780 ccp, - HD0779 manX, - HD0768 oadB, - HD0782 HD0770 phnA, - HD0781 HD0771 HD0777 HD0775 dsrA, - HD0769 fabH, - HD0774 plsX, - HD0773 rpL32, - HD0772 HD0778 HD0776
* Calculated from Protein Sequence

Gene ID: HD0774

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fabH  

Definition:
3-oxoacyl-[acyl-carrier-protein] synthase III

Gene Start:
607496

Gene Stop:
608446

Gene Length:
951

Molecular Weight*:
33757

pI*:
5.00

Net Charge*:
-8.68

EC:
2.3.1.41  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Primary Evidence:
NULL

Secondary Evidence:
Tsay,J.T., Oh,W., Larson,T.J., Jackowski,S. and Rock,C.O. Isolation and characterization of the beta-ketoacyl-acyl carrier protein synthase III gene (fabH) from Escherichia coli K-12.
J. Biol. Chem. 267(10):6807-6814, 1992.
Medline: 92202232.

Oh,W. and Larson,T.J.
Physical locations of genes in the rne (ams)-rpmF-plsX-fab region of the Escherichia coli K-12 chromosome.
J. Bacteriol. 174(23):7873-7874, 1992.
Medline: 93077479.

Zhang,Y. and Cronan,J.E. Jr.
Transcriptional analysis of essential genes of the Escherichia coli fatty acid biosynthesis gene cluster by functional replacement with the analogous Salmonella typhimurium gene cluster.
J. Bacteriol. 180(13):3295-3303, 1998.
Medline: 98317265.

Comment:
For other "fab" genes, see HD1188 (fabZ), HD1266 (fabI), HD0612 (fabB), HD0707 (fabD), HD0708 (fabG).

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to 3-oxoacyl-[acyl-carrier-protein] synthase III from H. influenzae (1169592), E. coli (119801), Salmonella typhimurium (6685438), among others. HD0774 is 75% similar to residues 1-316 from FABH_HAEIN.

HD0774 is similar to 3-oxoacyl-[acyl-carrier-protein] synthase III from C. pneumoniae (CPn0298) and C. trachomatis (CT239). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0332
COG name: 3-oxoacyl-[acyl-carrier-protein] synthase III
Functional Class:  I
The phylogenetic pattern of COG0332 is Amtkyq-ceBRhuj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 54-315 are 59% similar to a (SYNTHASE CHALCONE TRANSFERASE ACYLTRANSFERASE) protein domain (PD000453) which is seen in FABH_SALTY.

Residues 1-53 are 79% similar to a (III SYNTHASE) protein domain (PD003207) which is seen in Q9CJS8_PASMU.

Residues 156-234 are 72% similar to a (III SYNTHASE PROTEOME COMPLETE) protein domain (PD404420) which is seen in FABH_HAEIN.

Residues 87-307 are 25% similar to a (PROTEOME COMPLETE PA0998) protein domain (PD270250) which is seen in Q9I4X1_PSEAE.

Residues 236-314 are 88% similar to a (III SYNTHASE) protein domain (PD259222) which is seen in FABH_HAEIN.

Residues 68-155 are 76% similar to a (III SYNTHASE) protein domain (PD397240) which is seen in FABH_HAEIN.

Residues 4-149 are 29% similar to a (GUMO) protein domain (PD121795) which is seen in O34266_XANCA.



Paralogs:  Local Blast Search

HD0774 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1HN9|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synt... 401 5e-113
pdb|1EBL|A Chain A, The 1.8 A Crystal Structure And Active Site... 383 2e-107
pdb|1HNH|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synt... 381 6e-107

Gene Protein Sequence:
MYSKILATGSYLPKQVRSNADLEKMVDTTDEWIFTRSGMKERRIAAADET
VATMGAAAAHKACEMAAIDVNEIELIVVATTTHSHAYPSAACQIQGMLAI
EDAIAFDVAAACTGFIYALSVADQFIRAGKVKTAFVVGADVNSRVLDEAD
RGTVVLFGDGAGAVILQASEQAGILSTHLHSSADTDNMLALPIQERGNAQ
SGFIQMQGNATFKLAVSRLANVVEETLQANNLQKADLDWLVPHQANIRII
AATAKKLEMEMSQVVLTVEKYGNNSAATVPVALDEAVRDGRIQRGQLLLL
EAFGGGWTWGSGLVRF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACAGTAAGATTCTTGCGACGGGGAGTTACTTGCCAAAACAAGTAAG
ATCCAATGCTGATTTAGAAAAGATGGTCGATACAACAGATGAGTGGATTT
TTACTCGTTCAGGTATGAAAGAGCGCCGTATTGCGGCCGCTGATGAAACG
GTAGCCACAATGGGCGCCGCCGCCGCTCATAAGGCGTGTGAAATGGCAGC
CATTGATGTGAATGAGATTGAGTTGATTGTGGTGGCAACTACTACTCATT
CGCATGCTTATCCAAGTGCGGCGTGTCAAATTCAGGGCATGTTGGCCATT
GAAGATGCGATTGCATTTGATGTGGCAGCGGCGTGTACGGGGTTTATTTA
TGCGTTGAGTGTGGCAGATCAATTTATTCGTGCCGGTAAGGTGAAGACGG
CGTTTGTGGTTGGCGCAGATGTTAATTCTCGTGTGTTAGACGAGGCAGAT
CGCGGTACTGTGGTGTTATTTGGCGATGGTGCAGGGGCGGTGATTTTGCA
AGCGAGTGAACAAGCGGGTATTTTATCTACTCATTTGCATTCTTCAGCCG
ATACGGACAATATGTTGGCGTTGCCGATTCAAGAACGCGGAAATGCACAA
TCTGGTTTTATTCAGATGCAGGGTAATGCGACGTTTAAACTGGCAGTCAG
TCGGCTTGCAAATGTGGTAGAAGAGACATTACAAGCTAATAATTTGCAGA
AGGCGGATTTGGATTGGTTGGTGCCTCATCAAGCAAATATTCGGATTATT
GCGGCAACAGCTAAGAAGTTGGAAATGGAAATGTCGCAGGTGGTGTTAAC
GGTTGAGAAATATGGTAATAATAGTGCGGCAACCGTGCCTGTGGCATTAG
ATGAAGCGGTGCGAGATGGGCGGATTCAACGTGGGCAGTTGTTGCTGTTG
GAAGCTTTCGGCGGTGGTTGGACTTGGGGTTCGGGATTAGTCAGATTCTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy