Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR545 IGR552 IGR551 IGR549 IGR550 IGR553 IGR555 IGR548 IGR554 IGR547 IGR556 IGR546 yhjA,ccp, - HD0780 ccp, - HD0779 manY,ptnC, - HD0767 manX, - HD0768 HD0770 rpL32, - HD0772 HD0778 HD0776 HD0771 HD0777 HD0775 dsrA, - HD0769 fabH, - HD0774 plsX, - HD0773 yhjA,ccp, - HD0780 ccp, - HD0779 manY,ptnC, - HD0767 manX, - HD0768 HD0770 rpL32, - HD0772 HD0778 HD0776 HD0771 HD0777 HD0775 dsrA, - HD0769 fabH, - HD0774 plsX, - HD0773 yhjA,ccp, - HD0780 ccp, - HD0779 manX, - HD0768 HD0770 manY,ptnC, - HD0767 HD0771 HD0777 HD0775 dsrA, - HD0769 fabH, - HD0774 plsX, - HD0773 rpL32, - HD0772 HD0778 HD0776
* Calculated from Protein Sequence

Gene ID: HD0773

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
plsX  

Definition:
fatty acid/phospholipid synthesis protein plsX

Gene Start:
606453

Gene Stop:
607484

Gene Length:
1032

Molecular Weight*:
37549

pI*:
10.10

Net Charge*:
10.22

EC:
 

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table

Secondary Evidence:
Oh,W. and Larson,T.J.
Physical locations of genes in the rne (ams)-rpmF-plsX-fab region of the Escherichia coli K-12 chromosome.
J. Bacteriol. 174(23):7873-7874,1992.
Medline: 93077479.

Zhang,Y. and Cronan,J.E. Jr.
Transcriptional analysis of essential genes of the Escherichia coli fatty acid biosynthesis gene cluster by functional replacement with the analogous Salmonella typhimurium gene cluster.
J. Bacteriol. 180(13):3295-3303,1998
Medline: 98317265.

Comment:
For other "pls" genes, see HD0049 (plsC) and HD0546 (plsB).

Blast Summary:  PSI-Blast Search
Residues 1-338 are 52% similar to >20141773 PLSX_PASMU Fatty acid/phospholipid synthesis protein plsX.

Many significant hits using gapped BLAST to fatty acid/phospholipid synthesis protein from E. coli (6686317), Salmonella typhimurium (6685745), Moritella marina (6045045), among others. HD0773 is 45% similar to residues 1-340 from PLSX_ECOLI.

HD0773 is similar to fatty acid/phospholipid synthesis protein from U. urealyticum (UU206), C. pneumoniae (CPn0962), C. trachomatis (CT811), M. genitalium (MG368), and M. pneumoniae (MP0296). No similarities to T. pallidum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0416
COG name: Fatty acid/phospholipid biosynthesis enzyme
Functional Class: I
The phylogenetic pattern of COG0416 is -----qvceb--ujgp--in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003664 (Fatty acid synthesis plsX protein) with a combined E-value of 7.7e-66.
    IPB003664A    4-27
    IPB003664B    105-135
    IPB003664C    178-192
    IPB003664D    211-244
    IPB003664E    283-320


ProDom Summary:  Protein Domain Search
Residues 11-338 are 52% similar to a (FATTY BIOSYNTHESIS ACID/PHOSPHOLIPID) protein domain (PD006974) which is seen in PLSX_PASMU.



Paralogs:  Local Blast Search
HD0773 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 331 (E-value = 6.3e-111) place HD0773 in the FA_synthesis family which is described as Fatty acid synthesis protein (PF02504)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LNRLTLALDVMGGDFGPRVTIPALSLALAQQPMLSFVLFGDQYHAIPLLH
SLPAEQQQRIRFVHTSRIVDPHVPVRQALRQSKGSSMRLAIEAVVAGEAQ
ACVSGGNTGVLMGLAKWFVEPLVGIDRPALASLIPALNGQASVMLDLGAN
VEADSKLLLQFAEMGNIFAQSILSLAQPRLALLNIGTEEVKGRYAIQQAH
HVLKNRADLHYIGFIESDKLMNHLADVIVCDGFCGNIALKAVEGVASHFL
ALFKQPKRSFFVDWLSSWWGRLLYHRVYRALQRVNPERHNGATLLGLSSV
VVKSHGSAGVNAYFYAINHAIEQIQNRIPVKISAGLQKLHQNL$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAATCGTCTAACCCTTGCGTTAGATGTGATGGGCGGGGACTTTGGTCC
CCGTGTTACTATCCCGGCATTATCTCTAGCATTGGCACAACAGCCGATGC
TATCTTTTGTTCTATTTGGCGATCAATATCACGCTATTCCTTTATTGCAT
TCCCTTCCTGCTGAACAGCAACAACGTATTCGTTTTGTGCATACTTCGCG
GATTGTTGATCCGCATGTGCCAGTGCGTCAGGCATTACGCCAAAGTAAAG
GCAGTTCAATGCGTTTGGCGATTGAGGCGGTCGTCGCTGGTGAAGCGCAG
GCTTGTGTCAGTGGCGGTAATACGGGCGTGTTAATGGGCTTGGCAAAATG
GTTTGTCGAGCCGTTAGTCGGTATTGATCGCCCTGCGTTGGCGAGTTTAA
TTCCTGCCTTAAATGGCCAAGCGAGTGTGATGTTAGATTTGGGCGCTAAT
GTGGAGGCTGACAGTAAATTGTTGTTGCAATTTGCTGAGATGGGCAATAT
TTTCGCACAGTCTATTTTGTCGTTAGCGCAGCCTCGTTTGGCGTTGTTGA
ATATTGGTACGGAAGAAGTAAAAGGTCGCTATGCTATTCAGCAGGCGCAT
CATGTATTGAAAAATCGTGCAGATTTACATTATATTGGCTTTATTGAAAG
TGATAAGTTGATGAATCATTTAGCTGATGTGATTGTGTGTGATGGCTTTT
GTGGCAATATCGCTTTGAAGGCGGTAGAAGGTGTGGCAAGTCATTTTTTG
GCGCTATTTAAGCAGCCTAAGCGGTCGTTTTTTGTGGATTGGTTGTCTAG
TTGGTGGGGGCGTTTGTTGTACCATCGTGTTTATCGTGCATTGCAGCGGG
TTAATCCAGAACGGCATAATGGCGCGACTTTGCTTGGTTTGTCTTCTGTG
GTGGTGAAAAGCCATGGCAGTGCGGGCGTAAATGCGTATTTTTATGCGAT
AAATCATGCAATTGAGCAGATCCAAAATCGAATACCTGTTAAAATTTCTG
CCGGTTTACAAAAGTTACATCAGAATTTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy