Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR545 IGR551 IGR549 IGR550 IGR541 IGR543 IGR548 IGR544 IGR547 IGR542 IGR546 ygbO, - HD0760 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 rpL32, - HD0772 HD0771 tpiA, - HD0762 dsrA, - HD0769 fabH, - HD0774 plsX, - HD0773 ygbO, - HD0760 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 rpL32, - HD0772 HD0771 tpiA, - HD0762 dsrA, - HD0769 fabH, - HD0774 plsX, - HD0773 ygbO, - HD0760 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 HD0771 tpiA, - HD0762 dsrA, - HD0769 plsX, - HD0773 rpL32, - HD0772 fabH, - HD0774
* Calculated from Protein Sequence

Gene ID: HD0768

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
manX  

Definition:
mannose-specific phosphotransferase element

Gene Start:
602989

Gene Stop:
602009

Gene Length:
981

Molecular Weight*:
35372

pI*:
5.70

Net Charge*:
-4.63

EC:
2.7.1.69  

Functional Class:
Energy metabolism; Sugars  
Transport and binding proteins; PTS system  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
Erni,B., Zanolari,B. and Kocher,H.P.
The mannose permease of Escherichia coli consists of three different proteins. Amino acid sequence and function in sugar transport, sugar phosphorylation, and penetration of phage lambda DNA.
J. Biol. Chem. 262(11):5238-5247, 1987.
Medline: 87165962.

Lortie,L.A., Pelletier,M., Vadeboncoeur,C. and Frenette,M.
The gene encoding IIABLMan in Streptococcus salivarius is part of a tetracistronic operon encoding a phosphoenolpyruvate:mannose/glucose phosphotransferase system. Microbiology 146:677-685,2000.

Nunn,R.S., Markovic-Housley,Z., Genovesio-Taverne,J.C.,
Flukiger,K., Rizkallah,P.J., Jansonius,J.N., Schirmer,T. and
Erni,B.
Structure of the IIA domain of the mannose transporter from
Escherichia coli at 1.7 angstroms resolution
Journal of molecular biology. 259 (3), 502-511 (1996)
MEDLINE: 96256525

Markovic-Housley,Z., Balbach,J., Stolz,B. and
Genovesio-Taverne,J.C.
Predicted topology of the N-terminal domain of the hydrophilic
subunit of the mannose transporter of Escherichia coli
FEBS letters. 340 (3), 202-206 (1994)
MEDLINE: 94178365

Gschwind,R.M., Gemmecker,G., Leutner,M., Kessler,H., Gutknecht,R.,
Lanz,R., Flukiger,K. and Erni,B.
Secondary structure of the IIB domain of the Escherichia coli
mannose transporter, a new fold in the class of alpha/beta twisted
open-sheet structures
FEBS letters. 404 (1), 45-50 (1997)
MEDLINE: 97228575


Comment:
For other PTS related genes, see HD1859 (ptsII), HD0585 (ptsN), HD0227, HD0766 (ptnD), HD0767 (ptnC).

Blast Summary:  PSI-Blast Search
Residues 1-326 are 74% similar to 12721142unknown [Pasteurella multocida].

Several significant hits using gapped BLAST to mannose-specific phosphotransferase element IIAB from E. coli (548622) and Streptococcus salivarius (5669855). Also hits to either the C-terminus of this protein (EIIB domain) or the N-terminus (EIIA domain). HD0768 is 57% similar to residues 1-320 from PTNA_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 166-320 are 89% similar to a (COMPONENT SYSTEM PHOSPHOTRANSFERASE IIB) protein domain (PD008332) which is seen in Q9CMJ0_PASMU.

Residues 22-130 are 55% similar to a (SYSTEM PTS N DOMAIN) protein domain (PD009343) which is seen in Q47350_ECOLI.

Residues 3-116 are 33% similar to a (COMPONENT SYSTEM IIA PHOSPHOTRANSFERASE) protein domain (PD403187) which is seen in PTFA_BACSU.

Residues 1-123 are 75% similar to a (COMPONENT SYSTEM COMPLETE PROTEOME) protein domain (PD328938) which is seen in Q9CMJ0_PASMU.



Paralogs:  Local Blast Search
HD0768 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 120 (E-value = 1.8e-39) place HD0768 in the EIIA-man family which is described as PTS system fructose IIA component (PF03610)
Residues 165 to 315 (E-value = 3.6e-96) place HD0768 in the PTSIIB_sorb family which is described as PTS system sorbose subfamily IIB component (PF03830)

PDB Hit:
pdb|1BLE| Phosphoenolpyruvate-Dependent Phosphotransferase Sy... 159 4e-040
pdb|1PDO| Phosphoenolpyruvate-Dependent Phosphotransferase S... 150 2e-037

Gene Protein Sequence:
MRIGIIIATHGVAAEQLLNTCEILIGKQTDVAYIDFVAGENADTIMTKYQ
EKLANQLAECDALLFLVDTWGGSPFNAANRLINGKANMNIITGVNVPMLV
ETFMARDDGLSLAELVEIALEAGRLGVRALNEPSTQAEKTTQAINNTTVT
NNATPAAALAGRHLTIGLARIDDRLIHGQVATRWTKESKVSRIVVVNDEV
AKDSVRSTMLKSVAPPGVTAHVVDVAKMIRVYHNAEYAGERMMLLFTNPT
DVVTLMEAGVAFDSINIGGMAYKEGKKMITSAVAVGDEDIAAFKTLHEKG
IELDVRKVSNDTRQYMMDLLKKNQLI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAATTGGGATAATAATTGCAACTCACGGAGTGGCTGCTGAGCAGCT
GCTCAACACTTGTGAGATCTTAATAGGTAAACAGACGGATGTCGCTTATA
TTGATTTTGTAGCCGGTGAAAATGCCGATACCATTATGACTAAATACCAA
GAAAAATTAGCTAATCAATTAGCTGAATGTGATGCGTTACTATTTTTAGT
CGATACTTGGGGCGGTAGCCCGTTTAATGCCGCTAATCGGTTGATTAATG
GCAAAGCCAATATGAATATCATTACCGGCGTGAATGTGCCGATGTTGGTA
GAAACTTTTATGGCACGTGATGACGGTTTATCATTAGCTGAATTAGTCGA
AATTGCCTTAGAAGCAGGGCGATTGGGCGTGCGAGCGTTAAATGAGCCAA
GCACGCAAGCAGAAAAAACTACGCAAGCGATTAATAATACAACAGTAACC
AACAACGCTACGCCAGCCGCTGCGCTAGCAGGCCGGCATTTAACCATTGG
GTTAGCTCGGATTGATGATCGGTTAATTCACGGCCAGGTGGCAACTCGTT
GGACTAAAGAAAGTAAAGTGTCGCGGATTGTGGTGGTGAATGATGAAGTG
GCAAAAGACAGTGTGCGTTCGACGATGTTAAAAAGTGTCGCACCGCCAGG
GGTAACCGCGCATGTGGTCGATGTCGCGAAAATGATTCGGGTATATCACA
ATGCGGAATACGCTGGCGAGCGGATGATGTTGTTATTTACGAATCCAACT
GATGTGGTCACGTTAATGGAAGCGGGCGTGGCGTTTGATTCCATTAATAT
TGGCGGTATGGCGTATAAAGAAGGCAAAAAGATGATTACCAGCGCGGTGG
CAGTGGGCGATGAAGATATTGCTGCATTTAAGACGCTACACGAAAAAGGG
ATTGAATTAGATGTGCGTAAGGTTTCAAACGATACCCGCCAATATATGAT
GGATTTATTGAAGAAAAATCAGTTGATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy