Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR545 IGR549 IGR550 IGR541 IGR540 IGR543 IGR548 IGR544 IGR547 IGR542 IGR546 ygbO, - HD0760 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 rpL32, - HD0772 HD0771 tpiA, - HD0762 dsrA, - HD0769 plsX, - HD0773 ygbO, - HD0760 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 rpL32, - HD0772 HD0771 tpiA, - HD0762 dsrA, - HD0769 plsX, - HD0773 ygbO, - HD0760 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 ygbO, - HD0759 tpiA, - HD0762 dsrA, - HD0769 plsX, - HD0773 HD0771 rpL32, - HD0772
* Calculated from Protein Sequence

Gene ID: HD0767

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
manY  ptnC  

Definition:
mannose-specific phosphotransferase system IIC

Gene Start:
601999

Gene Stop:
601199

Gene Length:
801

Molecular Weight*:
27933

pI*:
5.90

Net Charge*:
-3.71

EC:
2.7.1.69  

Functional Class:
Energy metabolism; Sugars  
Transport and binding proteins; PTS system  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
Erni,B., Zanolari,B. and Kocher,H.P.
The mannose permease of Escherichia coli consists of three different proteins. Amino acid sequence and function in sugar transport, sugar phosphorylation, and penetration of phage lambda DNA.
J. Biol. Chem. 262(11):5238-5247,1987.
Medline: 87165962.

Wehmeier,U.F. and Lengeler,J.W.
Sequence of the sor-operon for L-sorbose utilization from Klebsiella pneumoniae KAY2026.
Biochim. Biophys. Acta 1208(2):348-351,1994.
Medline: 95035038.

Martin-Verstraete,I., Debarbouille,M., Klier,A. and Rapoport,G.
Levanase operon of Bacillus subtilis includes a fructose-specific phosphotransferase system regulating the expression of the operon. J. Mol. Biol. 214(3):657-671,1990.
Medline: 90355183.

Comment:
For other PTS related genes, see HD1859 (ptsII), HD0585 (ptsN), HD0227, HD0766 (ptnD), HD0768 (ptnA).

Blast Summary:  PSI-Blast Search
Residues 1-266 are 84% similar to 15602698 PtnC [Pasteurella multocida]. Residues 1-249 are 86% similar to 23467699 hypothetical protein [Haemophilus somnus 129PT].

Several significant hits using gapped BLAST to mannose-specific phosphotransferase system IIC component from E. coli (131501), to sorbose-specific phosphotransferase system IIC component from Klebsiella pneumoniae (548633), to fructose-specific phosphotransferase system IIC component from Bacillus subtilis (126220), among others. HD0767 is 70% similar to residues 1-266 from PTNC_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 136-249 are 52% similar to a (COMPONENT IIC SYSTEM PHOSPHOTRANSFERASE) protein domain (PD010825) which is seen in PTRC_KLEPN.

Residues 109-159 are 82% similar to a (COMPONENT IIC PHOSPHOTRANSFERASE SYSTEM) protein domain (PD082463) which is seen in Q9CMJ1_PASMU.

Residues 1-127 are 70% similar to a (COMPONENT IIC SYSTEM PHOSPHOTRANSFERASE) protein domain (PD009389) which is seen in PTRC_KLEPN.



Paralogs:  Local Blast Search
HD0767 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 238 (E-value = 8.7e-137) place HD0767 in the EII-Sor family which is described as PTS system sorbose-specific iic component (PF03609)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MEISTLQVILVFLVACVCGAGSILDEFQTHRPLIACTLIGLVLGDLTTGI
IVGGSLELLALGWMNIGAALAPDTALASVIATILVIVGKQDISTGIAVAI
PLAAAGQVLTYVVRAITVGFQHAADKSVLDGNLARLDWIHFTALLLQAMR
IAIPALIVALTAGTDAVQMMLQAIPDVVTTGLKIAGGFIAVVGYAMVINM
MRAGHLMPFFYAGFVVAAFTDFNLVALGVLGTIMAVIYIQIHPKYHKSQQ
VVTLPTANNELDNRLD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAATTTCAACTTTACAGGTTATTTTGGTCTTTTTGGTTGCTTGCGT
TTGTGGCGCGGGCTCAATTTTAGATGAATTTCAAACGCATCGCCCGTTAA
TTGCGTGTACATTGATCGGGTTGGTGTTAGGCGATTTAACCACCGGTATT
ATTGTTGGCGGTTCGTTAGAGTTATTAGCCTTAGGCTGGATGAACATTGG
TGCGGCGTTAGCGCCAGATACGGCGTTGGCTTCGGTGATTGCCACTATTT
TGGTGATTGTCGGCAAGCAAGATATTTCGACCGGTATTGCGGTAGCCATT
CCGTTAGCCGCCGCTGGGCAGGTGTTAACTTATGTGGTGCGTGCGATTAC
GGTCGGTTTTCAACACGCGGCGGATAAGTCGGTGCTTGATGGTAATTTAG
CCCGCTTAGATTGGATTCATTTCACGGCGTTGTTGTTGCAAGCGATGCGA
ATTGCTATTCCTGCGTTAATCGTGGCATTAACCGCCGGTACAGATGCGGT
GCAAATGATGTTGCAAGCCATTCCGGATGTGGTGACAACCGGTCTAAAAA
TTGCCGGTGGCTTTATTGCAGTGGTCGGTTATGCGATGGTGATCAATATG
ATGCGTGCCGGCCATTTAATGCCGTTCTTTTATGCGGGCTTTGTGGTCGC
CGCCTTTACTGATTTTAATTTGGTGGCATTAGGTGTGTTAGGCACGATTA
TGGCGGTGATTTATATTCAAATTCATCCAAAATACCATAAGAGCCAACAG
GTAGTCACGCTGCCAACCGCTAATAATGAACTTGATAATAGATTAGATTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy