Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR545 IGR541 IGR540 IGR543 IGR548 IGR544 IGR547 IGR542 IGR546 ygbO, - HD0760 HD0757 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 HD0771 tpiA, - HD0762 dsrA, - HD0769 ygbO, - HD0760 HD0757 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 HD0771 tpiA, - HD0762 dsrA, - HD0769 ygbO, - HD0760 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 manA,pmi, - HD0765 HD0770 HD0757 HD0771 tpiA, - HD0762 dsrA, - HD0769
* Calculated from Protein Sequence

Gene ID: HD0766

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
manZ  ptnD  

Definition:
mannose-specific phosphotransferase system IID

Gene Start:
601199

Gene Stop:
600348

Gene Length:
852

Molecular Weight*:
30764

pI*:
10.30

Net Charge*:
7.19

EC:
2.7.1.69  

Functional Class:
Energy metabolism; Sugars  
Transport and binding proteins; PTS system  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
Erni,B., Zanolari,B. and Kocher,H.P.
The mannose permease of Escherichia coli consists of three different proteins. Amino acid sequence and function in sugar transport, sugar phosphorylation, and penetration of phage lambda DNA.
J. Biol. Chem. 262(11):5238-5247, 1987.
Medline: 87165962.

Martin-Verstraete,I., Debarbouille,M., Klier,A. and Rapoport,G.
Levanase operon of Bacillus subtilis includes a fructose-specific phosphotransferase system regulating the expression of the operon. J. Mol. Biol. 214(3):657-671,1990.
Medline: 90355183.

Comment:
For other PTS related genes, see HD1859 (ptsII), HD0585 (ptsN), HD0227, HD0768 (ptnA), HD0767 (ptnC).

Blast Summary:  PSI-Blast Search
Residues 6-261 are 76% similar to 12721140 PtnD [Pasteurella multocida].

Otherwise, several significant hits using gapped BLAST to mannose-specific phosphotransferase system IID component from E. coli (131485), fructose-specific phosphotransferase system IID component from Bacillus subtilis (126221), sorbose-specific phosphotransferase system IID component from Klebsiella pneumoniae (548634), among others. HD0766 is 64% similar to residues 4-263 from PTND_ECOLI.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 12-261 are 76% similar to a (COMPONENT IID SYSTEM PHOSPHOTRANSFERASE) protein domain (PD013894) which is seen in Q9CMJ2_PASMU.



Paralogs:  Local Blast Search
HD0766 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 11 to 282 (E-value = 1.7e-180) place HD0766 in the EIID-AGA family which is described as PTS system mannose/fructose/sorbose family IID component (PF03613)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MENATMTTEIKKVTKSDLNAVVLRSNFFQGSWNFERMQALGFMYSISPVI
KRLYPDPNSQARKDAIKRHLEFFNTQPFVAAPVLGVTIAMEEERANGKPI
DDAAINGIKVGLMGPLAGVGDPIYWGTARPVFAALGAGLALSGSLLGPLL
FFFLFNAVRLATRYYGVIYGYKKGLDVVKDMSGGLLQKLTEGASILGLFI
MGALVQKWTSINVPLVVSTIKKQDGTVEVTTVQSILDSLMPGLLPLLLTF
ACMWLLRNRVNALWIIIGFFAIGILGAWAGVLA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGAATGCGACGATGACAACAGAAATTAAAAAAGTAACCAAAAGCGA
TTTAAACGCGGTTGTGCTTCGCTCTAACTTTTTCCAAGGTTCGTGGAACT
TCGAAAGAATGCAGGCGTTAGGTTTTATGTATTCCATTTCGCCGGTGATT
AAACGTTTATATCCTGATCCAAACTCTCAGGCACGTAAAGATGCGATTAA
GCGACATTTAGAATTCTTTAATACTCAGCCGTTTGTTGCCGCGCCGGTGT
TAGGCGTGACCATTGCGATGGAGGAAGAACGCGCTAACGGTAAGCCTATC
GATGATGCTGCCATCAATGGCATTAAAGTAGGGCTGATGGGGCCTTTGGC
TGGGGTGGGCGATCCAATTTATTGGGGAACCGCTCGTCCGGTGTTTGCCG
CTTTAGGCGCAGGCTTGGCATTAAGCGGTAGTTTATTAGGGCCGTTGTTA
TTTTTCTTTTTATTTAATGCGGTGCGCTTAGCTACTCGTTATTATGGCGT
GATCTATGGCTATAAAAAAGGCTTAGATGTGGTGAAAGATATGAGCGGCG
GCTTATTGCAAAAGCTTACGGAAGGCGCGTCTATTCTGGGTCTGTTTATT
ATGGGGGCATTAGTGCAGAAATGGACAAGCATTAATGTGCCGTTGGTTGT
TTCAACCATTAAAAAGCAGGACGGTACTGTTGAGGTGACGACAGTGCAAA
GTATTTTAGATAGCTTAATGCCGGGCTTGTTGCCGTTGTTGTTGACTTTT
GCTTGTATGTGGTTATTGCGTAACCGTGTCAATGCGCTATGGATTATTAT
CGGCTTCTTTGCAATCGGTATTTTAGGCGCTTGGGCAGGTGTCCTTGCTT
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy