Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR545 IGR538 IGR541 IGR540 IGR537 IGR543 IGR544 IGR547 IGR542 IGR546 ygbO, - HD0760 lppB, - HD0756 HD0757 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 nlpD,lppB, - HD0755 manA,pmi, - HD0765 HD0770 tpiA, - HD0762 dsrA, - HD0769 ygbO, - HD0760 lppB, - HD0756 HD0757 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 nlpD,lppB, - HD0755 manA,pmi, - HD0765 HD0770 tpiA, - HD0762 dsrA, - HD0769 ygbO, - HD0760 HD0757 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 nlpD,lppB, - HD0755 manA,pmi, - HD0765 HD0770 lppB, - HD0756 tpiA, - HD0762 dsrA, - HD0769
* Calculated from Protein Sequence

Gene ID: HD0765

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
manA  pmi  

Definition:
mannose-6-phosphate isomerase

Gene Start:
600203

Gene Stop:
598977

Gene Length:
1227

Molecular Weight*:
46321

pI*:
6.40

Net Charge*:
-3.43

EC:
5.3.1.8  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Fructose and mannose metabolism

Secondary Evidence:
Miles,J.S. and Guest,J.R. 1984.
Nucleotide sequence and transcriptional start point of the phosphomannose isomerase gene (manA) of Escherichia coli.
Gene 32(1-2):41-48.
Medline: 85155484.

Collins,L.V. and Hackett,J. 1991.
Sequence of the phosphomannose isomerase-encoding gene of Salmonella typhimurium.
Gene 103(1):135-136.
Medline: 91348522.

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to mannose-6-phosphate isomerase from Borrelia burgdorferi (7437347), E. coli (126724), Salmonella typhimurium (126726), among others. HD0765 is 32% similar to residues 7-369 from pir||F70150, mannose-6-phosphate isomerase from Borrelia burgdorferi.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1482
COG name: Phosphomannose isomerase
Functional Class: G
The phylogenetic pattern of COG1482 is a---y-v-eBr-----o----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001250 (Mannose-6-phosphate isomerase type I) with a combined E-value of 2.4e-51.
    IPB001250A    10-20
    IPB001250B    86-102
    IPB001250C    128-159
    IPB001250D    247-291


ProDom Summary:  Protein Domain Search
Residues 36-111 are 42% similar to a (ISOMERASE MANNOSE-6-PHOSPHATE) protein domain (PD004391) which is seen in MANA_HUMAN.

Residues 263-361 are 53% similar to a (ISOMERASE MANNOSE-6-PHOSPHATE PMI) protein domain (PD005872) which is seen in Q9CMJ5_PASMU.

Residues 135-261 are 57% similar to a (PROTEOME COMPLETE PMI) protein domain (PD397059) which is seen in Q9CMJ5_PASMU.

Residues 9-133 are 52% similar to a (ISOMERASE MANNOSE-6-PHOSPHATE PROTEOME) protein domain (PD295558) which is seen in Q9CMJ5_PASMU.



Paralogs:  Local Blast Search

HD0765 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 374 (E-value = 1.1e-51) place HD0765 in the PMI_typeI family which is described as Phosphomannose isomerase type I (PF01238)

PDB Hit:
pdb|1PMI| Human Rantes 125 1e-029

Gene Protein Sequence:
LEAITMIFQLKGKFQHYPWGGRYFIPHFLKLTEVVDQPYAEYWLGAHPAA
SATIKFGEQWLPLADVIKQAPELLGERSRQQFGDNLPYLLKILDIKQPLS
IQLHPNKAQAEYGFNQENRQGIPLEDVRRIYKDRNHKPEMMIALSDFWLL
HGFKSITAIQACLAKYPSTSALAKSLVEKSLAVVYAEIMHADQTQLASWL
RPIIEQRRADYLADKLKLSDPDYWLLYMTDDLAADAPLDAGLMCFYLFNI
VHLKKGEGIYQAANLPHAYLRGQSIELMANSDNVIRGGLTTKWVDIPALL
QAVDYRPVRPQIIAAYRDDKTVDQNFYLYPTPQAKDFALQRLTIRQLVEN
RFVTDSASMLLVMKGSLYIDLGNTSFHLNQGDAVFISADSHVELIGENDG
YAIIASLP$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAGGCTATAACAATGATCTTTCAACTTAAAGGTAAATTTCAGCACTA
CCCTTGGGGAGGGCGTTATTTTATTCCCCATTTCCTTAAATTAACGGAGG
TGGTCGATCAACCTTATGCTGAATATTGGTTAGGCGCTCATCCTGCTGCT
TCCGCTACGATTAAATTTGGTGAGCAGTGGCTACCATTGGCTGATGTGAT
TAAGCAAGCGCCTGAATTATTAGGCGAAAGAAGTCGGCAACAATTTGGGG
ACAATTTGCCTTATTTGTTGAAGATTTTGGATATAAAACAACCGCTTTCT
ATTCAGCTCCATCCCAATAAAGCGCAAGCAGAATATGGCTTTAATCAGGA
AAACCGTCAAGGTATTCCGTTAGAAGATGTTCGTCGTATTTATAAAGATC
GTAATCATAAGCCTGAGATGATGATTGCATTATCTGACTTTTGGTTACTG
CACGGTTTTAAATCTATTACGGCTATTCAAGCTTGTTTGGCTAAGTATCC
GTCAACAAGTGCGTTGGCTAAGTCGTTAGTCGAAAAAAGTTTGGCGGTCG
TTTATGCGGAAATTATGCACGCCGATCAAACTCAATTAGCGAGCTGGCTA
CGGCCGATCATTGAGCAGCGGCGGGCGGATTATTTAGCTGATAAGCTGAA
ACTGTCTGATCCTGATTATTGGTTGTTGTATATGACTGACGATTTGGCGG
CGGATGCGCCGTTAGATGCGGGGTTGATGTGTTTTTATTTGTTTAATATT
GTGCATTTGAAAAAAGGTGAGGGTATTTATCAAGCCGCTAATTTGCCACA
CGCTTATTTACGTGGGCAGAGCATTGAATTAATGGCAAATTCAGACAATG
TGATTCGGGGTGGTTTAACGACGAAATGGGTTGATATTCCGGCATTGTTG
CAAGCGGTTGATTATCGCCCTGTTCGTCCGCAAATTATTGCTGCTTATCG
TGATGATAAAACCGTCGATCAGAATTTTTATCTATACCCTACACCGCAGG
CGAAAGACTTCGCTTTACAGCGGTTGACGATCCGTCAATTAGTGGAAAAT
CGTTTTGTTACGGATAGTGCGTCGATGTTGTTAGTGATGAAAGGCAGTTT
ATATATTGATTTAGGCAATACGTCATTTCATCTTAATCAAGGTGATGCGG
TATTTATTAGCGCGGATAGTCATGTAGAGCTGATCGGTGAAAATGATGGC
TATGCGATTATTGCAAGTTTGCCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy