Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR545 IGR538 IGR541 IGR540 IGR537 IGR543 IGR544 IGR536 IGR542 IGR546 HD0754 ygbO, - HD0760 lppB, - HD0756 HD0757 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 nlpD,lppB, - HD0755 manA,pmi, - HD0765 tpiA, - HD0762 dsrA, - HD0769 HD0754 ygbO, - HD0760 lppB, - HD0756 HD0757 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 nlpD,lppB, - HD0755 manA,pmi, - HD0765 tpiA, - HD0762 dsrA, - HD0769 ygbO, - HD0760 lppB, - HD0756 HD0757 ygbO, - HD0759 surE, - HD0758 manY,ptnC, - HD0767 manZ,ptnD, - HD0766 manX, - HD0768 nlpD,lppB, - HD0755 manA,pmi, - HD0765 HD0754 tpiA, - HD0762 dsrA, - HD0769
* Calculated from Protein Sequence

Gene ID: HD0762

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpiA  

Definition:
triosephosphate isomerase

Gene Start:
598102

Gene Stop:
598872

Gene Length:
771

Molecular Weight*:
27136

pI*:
5.00

Net Charge*:
-6.22

EC:
5.3.1.1  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycerolipid metabolism
Glycolysis / Gluconeogenesis

Secondary Evidence:
Pichersky,E., Gottlieb,L.D. and Hess,J.F. 1984.
Nucleotide sequence of the triose phosphate isomerase gene of Escherichia coli.
Mol. Gen. Genet. 195(1-2):314-320.
Medline: 85035844.


Tao H, Gonzalez R, Martinez A, Rodriguez M, Ingram LO, Preston JF, Shanmugam KT.
Engineering a homo-ethanol pathway in Escherichia coli: increased glycolytic flux and levels of expression of glycolytic genes during xylose fermentation.
J Bacteriol. 2001 May;183(10):2979-88.
PMID: 11325924



Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to triosephosphate isomerase from H. influenzae (1174746), Enterobacter cloacae (8134748), E. coli (418126), among others. HD0762 is 81% similar to residues 1-248 from TPIS_HAEIN.

HD0762 is similar to triosephosphate isomerase from C. pneumoniae (CPn1063), T. pallidum (TP0537), C. trachomatis (CT328), M. pneumoniae (MP0213), M. genitalium (MG431), and U. urealyticum (UU181).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0149
COG name: Triosephosphate isomerase
Functional Class: G
The phylogenetic pattern of COG0149 is amtkyqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000652 (Triosephosphate isomerase) with a combined E-value of 2.4e-94.
    IPB000652A    6-16
    IPB000652B    74-114
    IPB000652C    122-148
    IPB000652D    165-189
    IPB000652E    208-239


ProDom Summary:  Protein Domain Search
Residues 3-241 are 80% similar to a (ISOMERASE TRIOSEPHOSPHATE TIM FATTY) protein domain (PD001005) which is seen in TPIS_HAEIN.



Paralogs:  Local Blast Search
HD0762 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 252 (E-value = 5.8e-147) place HD0762 in the TIM family which is described as Triosephosphate isomerase (PF00121)

PDB Hit:
pdb|1TRE|A Chain A, Triosephosphate Isomerase Tim (E.C.5.3.1.1)... 336 1e-093
pdb|1TMH|A Chain A, Triosephosphate Isomerase (E.C.5.3.1.1) Mut... 330 9e-092
pdb|1AW2|A Chain A, Triosephosphate Isomerase Of Vibrio Marinus... 315 3e-087

Gene Protein Sequence:
MARRPLVMGNWKLNGSKAFTQQLIAELKTELAEITGCDVAIAPPVMYLSE
AEIALAGQSTIRLGAQNVDINTQGAFTGDISTAMLQEFCAKYIIIGHSER
RTYHAESDQFIAKKFAALKTAGLTPVLCIGETEAENEAGQTQQVCARQID
AIINSLGVEAFNQAVIAYEPIWAIGTGKSATPAQAQAVHAFIRQHIAEKS
QAVADQLIIQYGGSVNDTNAAELFSQPDIDGALVGGASLKATAFAEIVKA
AEKAKA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACGTCGTCCACTTGTAATGGGTAACTGGAAATTAAACGGCAGTAA
AGCATTTACACAACAACTAATTGCCGAATTAAAAACAGAATTAGCTGAAA
TAACCGGTTGTGATGTAGCAATTGCACCACCGGTAATGTATTTATCAGAA
GCGGAAATAGCTTTAGCAGGGCAATCGACCATCCGCCTAGGCGCACAGAA
TGTTGATATAAATACCCAAGGAGCCTTTACAGGCGATATTTCCACCGCAA
TGTTACAAGAGTTTTGTGCGAAATACATTATTATCGGCCATTCAGAACGC
CGGACTTACCACGCAGAAAGCGATCAATTTATCGCAAAAAAATTCGCTGC
ATTAAAAACAGCAGGATTAACACCCGTATTATGTATTGGCGAAACAGAAG
CAGAGAATGAAGCCGGCCAAACACAACAAGTGTGCGCACGCCAAATTGAC
GCCATAATTAACAGCTTAGGCGTTGAAGCATTTAATCAAGCCGTTATCGC
TTATGAACCCATCTGGGCTATCGGCACAGGAAAATCCGCAACGCCAGCCC
AAGCCCAAGCCGTGCATGCCTTTATCCGCCAACATATCGCAGAAAAATCG
CAAGCCGTAGCAGACCAACTAATTATCCAATATGGCGGATCCGTAAACGA
CACCAATGCCGCAGAACTATTTAGCCAACCTGATATTGACGGTGCATTAG
TGGGAGGCGCATCCTTAAAAGCGACCGCATTTGCAGAGATCGTAAAAGCG
GCTGAAAAAGCCAAAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy