Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR538 IGR532 IGR534 IGR535 IGR541 IGR540 IGR537 IGR533 IGR529 IGR536 IGR542 IGR531 IGR530 HD0751 HD0754 rpL34, - HD0753 ygbO, - HD0760 rnpA, - HD0752 lppB, - HD0756 HD0757 ygbO, - HD0759 surE, - HD0758 nlpD,lppB, - HD0755 nhaA, - HD0747 HD0748 icc, - HD0749 glnA, - HD0750 HD0751 HD0754 rpL34, - HD0753 ygbO, - HD0760 rnpA, - HD0752 lppB, - HD0756 HD0757 ygbO, - HD0759 surE, - HD0758 nlpD,lppB, - HD0755 nhaA, - HD0747 HD0748 icc, - HD0749 glnA, - HD0750 ygbO, - HD0760 rnpA, - HD0752 lppB, - HD0756 HD0757 ygbO, - HD0759 surE, - HD0758 nlpD,lppB, - HD0755 nhaA, - HD0747 HD0751 rpL34, - HD0753 HD0754 HD0748 icc, - HD0749 glnA, - HD0750
* Calculated from Protein Sequence

Gene ID: HD0752

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rnpA  

Definition:
ribonuclease P protein component, rnpA

Gene Start:
593209

Gene Stop:
592838

Gene Length:
372

Molecular Weight*:
14327

pI*:
11.90

Net Charge*:
17.14

EC:
3.1.26.5  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Park BH, Choi YN, Park JW, Sim S, Gil MC, Kim S, Kim M, Lee Y.
Expression of C5 protein, the protein component of Escherichia coli RNase P, from the tac promoter.
Mol Cells. 1998 Feb 28;8(1):96-100.
PMID: 9571638

Hansen,F.G., Hansen,E.B. and Atlung,T. 1985.
Physical mapping and nucleotide sequence of the rnpA gene that encodes the protein component of ribonuclease P in Escherichia coli.
Gene 38(1-3):85-93.
Medline: 86056995.

Hansen,F.G., Hansen,E.B. and Atlung,T. 1982.
The nucleotide sequence of the dnaA gene promoter and of the adjacent rpmH gene, coding for the ribosomal protein L34, of Escherichia coli.
EMBO J. 1(9):1043-1048.
Medline: 84236082.

Skovgaard,O. 1990.
Nucleotide sequence of a Proteus mirabilis DNA fragment homologous to the 60K-rnpA-rpmH-dnaA-dnaN-recF-gyrB region of Escherichia coli.
Gene 93(1):27-34.
Medline: 91033012.

Comment:


Blast Summary:  PSI-Blast Search
Some moderately significant hits using gapped BLAST to ribonuclease P protein component. Positions 1 to 99 are 73% (E value 3e-37) similar to sp|P44306|RNPA_HAEIN (2507338) ribonuclease P protein component between positions 21 and 119 in Haemophilus influenzae Rd. Positions 1 to 97 are 59% (E value 5e-29) similar to sp|P06277|RNPA_ECOLI (133180) RNase P, protein component between positions 21 and 117 in E. coli. Positions 1 to 99 are 58% (E value 2e-28) similar to sp|P22835|RNPA_PROMI (gi:) RNase P protein component between positions 21 and 119 in Proteus mirabilis.

HD0752 is weakly similar to ribonuclease P protein component from C. pneumoniae (CPn0934) and C. trachomatis (CT784). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0594
COG name: RNase P protein component
Functional Class: L
The phylogenetic pattern of COG0594 is ------vcebrhujgpo-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000100 (Bacterial ribonuclease P protein) with a combined E-value of 2.7e-09.
    IPB000100    59-74


ProDom Summary:  Protein Domain Search
Residues 32-119 are 75% similar to a (COMPONENT RNA-BINDING NUCLEASE TRNA) protein domain (PD003629) which is seen in RNPA_PASMU.

Residues 32-114 are 74% similar to a (COMPONENT RNA-BINDING NUCLEASE TRNA) protein domain (PD291796) which is seen in RNPA_HAEIN.



Paralogs:  Local Blast Search


HD0752 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 113 (E-value = 1.3e-43) place HD0752 in the Ribonuclease_P family which is described as Ribonuclease P (PF00825)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VNKLTFSRELRLLAPIQFKAVFEQPYRASTAELTILARQNCVNTPRLGLT
VAKKHLKRAHDRNRIKRIVRESFRLKQHQLPNFDFVFVAKHGIGKLDNAT
LFATIDKLWTRHIRLSQQAQSKN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATAAGCTAACGTTTTCTCGGGAGCTACGTTTGTTAGCTCCCATTCA
ATTCAAAGCCGTGTTTGAACAACCATATCGTGCTAGCACAGCTGAACTTA
CTATTCTTGCTCGTCAAAATTGCGTTAATACGCCTCGTCTTGGGTTAACC
GTTGCTAAAAAGCATTTAAAACGTGCTCACGATCGCAATCGGATCAAACG
TATTGTGCGGGAAAGCTTCCGTTTAAAACAACATCAATTACCTAATTTTG
ACTTTGTCTTTGTTGCCAAGCATGGGATTGGTAAACTAGATAATGCTACG
CTTTTCGCAACCATAGATAAATTATGGACTCGTCATATTCGCCTCAGTCA
ACAAGCACAAAGCAAAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy