Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR538 IGR532 IGR534 IGR535 IGR540 IGR527 IGR537 IGR528 IGR533 IGR529 IGR536 IGR531 IGR530 HD0751 HD0754 rpL34, - HD0753 rnpA, - HD0752 HD0746 lppB, - HD0756 HD0757 surE, - HD0758 nlpD,lppB, - HD0755 nhaA, - HD0747 HD0745 HD0748 icc, - HD0749 glnA, - HD0750 HD0751 HD0754 rpL34, - HD0753 rnpA, - HD0752 HD0746 lppB, - HD0756 HD0757 surE, - HD0758 nlpD,lppB, - HD0755 nhaA, - HD0747 HD0745 HD0748 icc, - HD0749 glnA, - HD0750 rnpA, - HD0752 HD0746 lppB, - HD0756 HD0757 surE, - HD0758 nlpD,lppB, - HD0755 nhaA, - HD0747 HD0751 rpL34, - HD0753 HD0754 HD0745 HD0748 icc, - HD0749 glnA, - HD0750
* Calculated from Protein Sequence

Gene ID: HD0750

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glnA  

Definition:
glutamine synthetase

Gene Start:
591127

Gene Stop:
592557

Gene Length:
1431

Molecular Weight*:
52760

pI*:
5.30

Net Charge*:
-10.84

EC:
6.3.1.2  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Glutamate metabolism
Nitrogen metabolism
Peptideglycan biosynthesis

Secondary Evidence:
Miranda-Rios,J., Sanchez-Pescador,R., Urdea,M. and Covarrubias,A.A. 1987.
The complete nucleotide sequence of the glnALG operon of Escherichia coli K12.
Nucleic Acids Res. 15(6):2757-2770.
Medline: 87174797.

Colombo,G. and Villafranca,J.J. 1986.
Amino acid sequence of Escherichia coli glutamine synthetase deduced from the DNA nucleotide sequence.
J. Biol. Chem. 261(23):10587-10591.
Medline: 86278128.

Covarrubias,A.A. and Bastarrachea,F. 1983.
Nucleotide sequence of the glnA control region of Escherichia coli.
Mol. Gen. Genet. 190(1):171-175.
Medline: 83218556.

Steglitz-Morsdorf,U., Morsdorf,G. and Kaltwasser,H. 1993.
Cloning, heterologous expression, and sequencing of the Proteus vulgaris glnAntrBC operon and implications of nitrogen control on heterologous urease expression.
FEMS Microbiol. Lett. 106(2):157-164.
Medline: 93202435.

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits using gapped BLAST to glutamine synthetase. Positions 1 to 453 are 79% (E value 0.0) similar to sp|P43794|GLNA_HAEIN (1169927) glutamine synthetase between positions 23 and 472 in Haemophilus influenzae Rd. Positions 2 to 453 are 67% (E value 0.0) similar to sp|P28786|GLNA_PROVU (121375) glutamine synthetase between positions 20 and 468 in Proteus vulgaris. Positions 2 to 453 are 67% (E value e-180) similar to sp|P06711|GLNA_ECOLI (417057) glutamine synthetase between positions 20 and 468 in E. coli.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0174
COG name: Glutamine synthase
Functional Class: E
The phylogenetic pattern of COG0174 is amtkyqvCEbRhuj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001637 (Glutamine synthetase class-I adenylation site) with a combined E-value of 2.7e-226.
    IPB001637A    4-35
    IPB001637B    47-83
    IPB001637C    112-144
    IPB001637D    171-222
    IPB001637E    242-289
    IPB001637F    291-321
    IPB001637G    322-350
    IPB001637H    354-407
    IPB001637I    461-471
***** IPB001691 (Glutamine synthetase) with a combined E-value of 1.3e-59.
    IPB001691A    51-63
    IPB001691B    129-138
    IPB001691C    174-185
    IPB001691D    192-239
    IPB001691E    268-277
    IPB001691F    282-298
    IPB001691G    359-372


ProDom Summary:  Protein Domain Search
Residues 255-380 are 92% similar to a (LIGASE GLUTAMINE SYNTHETASE GLUTAMATE--AMMONIA FIXATION) protein domain (PD001057) which is seen in Q9CLP2_PASMU.

Residues 409-470 are 46% similar to a (LIGASE SYNTHETASE GLUTAMINE) protein domain (PD235029) which is seen in GLNA_ECOLI.

Residues 107-253 are 81% similar to a (LIGASE GLUTAMINE SYNTHETASE) protein domain (PD228027) which is seen in Q9CLP2_PASMU.

Residues 381-470 are 73% similar to a (LIGASE GLUTAMINE SYNTHETASE) protein domain (PD347271) which is seen in Q9CLP2_PASMU.

Residues 253-379 are 68% similar to a (LIGASE SYNTHETASE GLUTAMINE) protein domain (PD285991) which is seen in GLNA_FREDI.

Residues 53-98 are 89% similar to a (LIGASE GLUTAMINE SYNTHETASE GLUTAMATE--AMMONIA NITROGEN) protein domain (PD000821) which is seen in Q9CLP2_PASMU.



Paralogs:  Local Blast Search
HD0750 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 99 (E-value = 4.5e-35) place HD0750 in the Gln-synt_N family which is described as Glutamine synthetase, beta-Grasp domain (PF03951)
Residues 105 to 386 (E-value = 9.8e-158) place HD0750 in the Gln-synt_C family which is described as Glutamine synthetase, catalytic domain (PF00120)

PDB Hit:
pdb|1F52|A Chain A, Crystal Structure Of Glutamine Synthetase F... 642 0.0

Gene Protein Sequence:
MSVNRVLDLIKENDIKFVMLKFTDIKGKEHGVSLPVSLVVDDLEALFEEG
KMFDGSSVEGWKAINKADMLLMPISETAVVDPFAQIPTMTIRCSIYEPNT
MQPYDRDPRSIATRAENFLKSTGIADSVMFGPEPEFFLFDDVRYATEANN
VSYKIDDIEAMWNTNRKYEDGNNAYRPLKKGGYCAVAPLDSAHDIRSEMC
LIMEQMGLIIEAHHHEVATAGQNEIATKFNSLTLKADETQIYKYVVQNVA
IAHAKTACFMPKPFAGDNGSGMHCNMSLSKAGKNIFMGDKYAGLSETALY
YIGGIIKHAKALNAFTNPTTNSYKRLVPGFEAPVLLAYSASNRSASIRIP
AVTTPKATRIEARFPDPMANPYLCFAALLMAGLDGIINKIHPGDAMDKNL
YDLPPEELQDIPAVASSLAEALDALSTDFTFLTQGNVFSKAFIDAYIAIR
RKEVERLNMTPHPVEFEMYYAYSGLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGTAAACAGAGTACTTGATTTAATTAAAGAAAACGACATTAAATT
TGTTATGTTAAAATTTACCGATATTAAAGGTAAAGAACACGGTGTTTCAT
TACCAGTCAGCTTGGTTGTTGATGATCTAGAAGCACTATTTGAAGAAGGC
AAAATGTTTGATGGATCTTCTGTTGAAGGATGGAAAGCCATTAATAAAGC
CGATATGTTATTAATGCCGATTTCTGAAACGGCAGTGGTTGATCCTTTTG
CACAGATTCCAACAATGACGATCCGTTGCAGTATCTATGAACCAAATACC
ATGCAACCTTACGATCGTGATCCACGTTCAATTGCAACGCGAGCAGAAAA
CTTCTTAAAATCGACCGGTATTGCAGACAGCGTAATGTTTGGGCCCGAGC
CAGAATTTTTCTTATTTGATGATGTAAGATATGCTACCGAAGCCAATAAT
GTATCGTATAAAATCGATGATATTGAAGCGATGTGGAATACCAACCGCAA
ATATGAAGACGGCAATAACGCTTATCGCCCATTGAAAAAAGGTGGTTATT
GCGCGGTTGCTCCGCTTGACAGCGCACACGATATTCGTTCAGAAATGTGC
TTAATTATGGAACAAATGGGATTAATTATTGAAGCACATCATCACGAAGT
GGCTACAGCCGGACAAAATGAAATTGCGACTAAATTTAATAGCCTAACGC
TAAAAGCAGATGAAACGCAAATTTATAAATATGTAGTGCAAAATGTAGCG
ATTGCACACGCTAAAACGGCTTGCTTTATGCCAAAACCCTTTGCCGGAGA
TAATGGCTCAGGTATGCATTGTAATATGTCCTTAAGTAAAGCGGGTAAAA
ATATATTTATGGGTGATAAATATGCAGGATTATCTGAAACAGCCTTATAT
TATATCGGCGGTATTATTAAACACGCCAAAGCATTAAATGCATTCACAAA
CCCAACCACCAACTCTTATAAACGTTTAGTGCCAGGTTTTGAAGCACCAG
TTTTATTAGCATATTCTGCTAGTAATCGTTCCGCATCTATTCGTATTCCA
GCCGTCACAACCCCAAAAGCAACACGGATTGAAGCTCGCTTCCCTGATCC
AATGGCGAACCCATACTTATGTTTTGCGGCATTACTAATGGCAGGGCTTG
ATGGCATTATCAATAAGATCCATCCTGGTGATGCAATGGATAAAAATTTA
TATGATTTACCGCCAGAAGAATTGCAAGATATTCCTGCAGTTGCAAGCTC
ATTAGCAGAAGCCCTTGATGCGCTATCAACCGACTTCACTTTCTTAACAC
AAGGTAATGTATTCTCAAAAGCATTTATTGATGCTTACATTGCCATTCGC
CGTAAAGAAGTCGAACGCTTAAATATGACGCCACATCCAGTAGAATTTGA
AATGTATTACGCATATAGCGGACTAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy