Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR523 IGR525 IGR527 IGR524 IGR526 IGR528 IGR529 IGR531 IGR530 hfq, - HD0741 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 HD0748 icc, - HD0749 rbn, - HD0744 glnA, - HD0750 hfq, - HD0741 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 HD0748 icc, - HD0749 rbn, - HD0744 glnA, - HD0750 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 hfq, - HD0741 HD0748 icc, - HD0749 rbn, - HD0744 glnA, - HD0750 HD0745 HD0745
* Calculated from Protein Sequence

Gene ID: HD0746

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (possible endo-1,4-beta-xylanase A precursor)

Gene Start:
587613

Gene Stop:
587074

Gene Length:
540

Molecular Weight*:
21014

pI*:
8.30

Net Charge*:
5.82

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Secondary Evidence:
Shareck,F., Roy,C., Yaguchi,M., Morosoli,R. and Kluepfel,D. Sequences of three genes specifying xylanases in Streptomyces lividans. Gene 107(1):75-82, 1991.
Medline: 92077439.

Comment:


Blast Summary:  PSI-Blast Search
Residues 67-177 are 33% similar to 20141432 ENVE_SALTY Probable lipoprotein envE precursor. Otherwise, some weakly significant hits using gapped BLAST to endo-1,4-beta-xylanase from Streptomyces lividans (322292; 6226911), Drosophila melanogaster (7302894), Streptomyces olivaceoviridis (8569641), among others. Also similar to Chi35 protein of Streptomyces thermoviolaceus (6681672). HD0746 is 33% (E value 2e-09) similar to residues 32-158 of dbj|BAA88833.1 (AB016842) chi35 from Streptomyces thermoviolaceus. HD0746 is 40% (E value 8e-08) similar to residues 397-476 of pir||JS0589 endo-1,4-beta-xylanase A precursor from Streptomyces lividans.

No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0746 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 105 to 142 (E-value = 1.3e-05) place HD0746 in the Ricin_B_lectin family which is described as QXW lectin repeat (PF00652)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKTLGLFSIIGLLSGCVYAPPAVDHPIEDTVVIQSEHHHTIYHESDKYDR
DKYDRNDRYPHYRYTGEIRTYWGECLDQSRSNYKGIISYRCHGGDNQRFT
FYRDSIRVNGQCLDVGSENKFDGARIIAYRCHGGKNQRWFRQGHQIRSEM
NGKCLEVGRDRNKLTLQQCDGSRSQQFFY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACATTAGGCCTATTTAGCATTATTGGCTTGCTGTCTGGTTGTGT
ATATGCACCTCCCGCGGTCGATCACCCGATTGAAGATACTGTCGTTATTC
AATCAGAGCATCACCACACGATTTATCACGAAAGCGATAAGTATGATCGT
GATAAATATGATAGAAATGACCGCTATCCACATTACCGTTACACCGGTGA
GATTCGCACCTATTGGGGCGAATGTTTAGATCAAAGCCGTTCCAACTATA
AAGGGATTATTAGCTATCGTTGCCATGGTGGCGATAATCAGCGCTTTACA
TTCTATCGCGATAGTATCCGTGTTAATGGGCAATGTTTAGATGTCGGCAG
CGAAAATAAATTTGATGGCGCTCGTATTATTGCTTATCGTTGTCACGGTG
GCAAAAACCAGCGTTGGTTCCGTCAAGGGCATCAAATTCGTAGTGAAATG
AATGGAAAATGTTTAGAGGTGGGCAGAGACCGTAATAAACTCACGTTACA
ACAATGTGATGGTAGCCGTAGTCAACAATTTTTCTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy