Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR523 IGR525 IGR527 IGR524 IGR526 IGR528 IGR529 IGR531 IGR530 hfq, - HD0741 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 HD0748 icc, - HD0749 rbn, - HD0744 glnA, - HD0750 hfq, - HD0741 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 HD0748 icc, - HD0749 rbn, - HD0744 glnA, - HD0750 hfq, - HD0741 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 HD0748 icc, - HD0749 rbn, - HD0744 glnA, - HD0750 HD0745 HD0745
* Calculated from Protein Sequence

Gene ID: HD0744

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rbn  

Definition:
ribonuclease BN

Gene Start:
585745

Gene Stop:
586572

Gene Length:
828

Molecular Weight*:
31304

pI*:
7.00

Net Charge*:
0.00

EC:
3.1.-.-  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Callahan,C. and Deutscher,M.P. 1996.
Identification and characterization of the Escherichia coli rbn gene encoding the tRNA processing enzyme RNase BN.
J. Bacteriol. 178(24):7329-7332.
Medline: 97113562.

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits using gapped BLAST to ribonuclease BN. Positions 41 to 299 are 49% (E value 6e-70) similar to sp|P44608|RBN_HAEIN (1176326) ribonuclease BN between positions 7 and 263 in Haemophilus influenzae Rd. Positions 49 to 304 are 39% (E value 1e-49) similar to sp|P32146|RBN_ECOLI (418487) ribonuclease BN between positions 24 and 280 in Escherichia coli. Positions 57 to 289 are 29% (E value 3e-26) similar to gb|AAC33456.1| (AF067083) (3493604) unknown between positions 19 and 251 in Vitreoscilla sp.

HD0744 is similar to hypothetical protein from C. pneumoniae (CPn0188) and C. trachomatis (CT132). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1295
COG name: tRNA-processing ribonuclease BN
Functional Class: J
The phylogenetic pattern of COG1295 is -----q-cEbRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 20-259 are 39% similar to a (COMPLETE PROTEOME RIBONUCLEASE BN) protein domain (PD007690) which is seen in Q9KNJ6_VIBCH.

Residues 26-235 are 52% similar to a (PROTEOME COMPLETE YFKH MEMBRANE) protein domain (PD296407) which is seen in Q9CKJ9_PASMU.



Paralogs:  Local Blast Search
HD0744 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 268 (E-value = 8e-70) place HD0744 in the Ribonuclease_BN family which is described as Ribonuclease BN-like family (PF03631)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MVMNKLILFGSIFFKCWQQNRISISAGYLTYNTMLALVPLVMVVFSVFTF
FPIFTEATELLKTFVYDNFAPNAGNVVEEYVELFVSNSQKMGLVSMLGLF
IVAVMLISSIDQSLNDIWHNTRKRSLLLSFLLYILILIFAPLLAGASIAI
TTYIMSFEVFSENGIFSFSHYLLEYAPFLLVWLLFTLVYWIVPNTTVAFR
HATIGALFAASFFTLGKQAFIWYVVTFPSYQAIYGTLAVLPIMIVWIHLS
WQVVLLGGQFAAVLKEINMLKENER$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTATGAATAAATTAATATTATTTGGCAGTATTTTTTTTAAGTGTTG
GCAACAGAACAGAATTTCTATATCAGCAGGTTATTTAACCTATAACACAA
TGTTAGCCTTAGTGCCATTAGTGATGGTGGTCTTTTCGGTGTTTACATTT
TTTCCTATTTTTACTGAAGCCACGGAATTATTGAAAACCTTTGTTTACGA
TAATTTTGCACCCAATGCGGGCAATGTTGTAGAAGAATATGTTGAGCTGT
TTGTGAGCAATTCACAGAAAATGGGGCTAGTCAGTATGTTAGGGCTGTTT
ATTGTGGCAGTGATGCTGATCTCAAGCATTGATCAAAGCTTGAATGATAT
TTGGCATAATACCCGTAAGCGCTCACTTTTGCTCTCTTTTTTGCTCTATA
TTCTGATCCTAATTTTTGCCCCATTATTAGCGGGGGCAAGTATTGCAATT
ACTACCTATATTATGTCGTTTGAAGTATTCAGCGAAAACGGCATTTTTTC
ATTTAGCCACTACTTATTGGAATATGCACCATTCTTGTTGGTTTGGTTAT
TATTCACTTTAGTTTATTGGATCGTGCCAAATACGACCGTGGCTTTTCGA
CATGCAACTATTGGCGCATTATTTGCGGCGAGTTTTTTTACGTTAGGCAA
ACAGGCATTTATTTGGTATGTGGTAACTTTTCCTTCTTACCAAGCGATTT
ATGGCACTTTAGCTGTGTTACCCATTATGATTGTTTGGATTCATCTAAGC
TGGCAAGTTGTGTTATTAGGTGGGCAATTTGCGGCTGTTTTAAAAGAAAT
CAATATGCTTAAGGAGAATGAGCGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy