Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR520 IGR523 IGR525 IGR527 IGR522 IGR524 IGR521 IGR519 IGR526 IGR528 hfq, - HD0741 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 HD0737 ttk, - HD0735 crp, - HD0738 rbn, - HD0744 dfp, - HD0733 hfq, - HD0741 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 HD0737 ttk, - HD0735 crp, - HD0738 rbn, - HD0744 dfp, - HD0733 hfq, - HD0741 HD0746 trpX, - HD0742 nhaA, - HD0747 hflX, - HD0740 mutL, - HD0743 ttk, - HD0735 crp, - HD0738 rbn, - HD0744 dfp, - HD0733 HD0745 dut, - HD0734 HD0745 dut, - HD0734 HD0737
* Calculated from Protein Sequence

Gene ID: HD0742

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
trpX  

Definition:
tRNA delta(2)-isopentenylpyrophosphate transferase

Gene Start:
583777

Gene Stop:
582836

Gene Length:
942

Molecular Weight*:
35206

pI*:
6.70

Net Charge*:
-1.48

EC:
2.5.1.-  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Biosynthesis and degradation of glycoprotein
Porphyrin and chlorophyll metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Connolly,D.M. and Winkler,M.E. 1991.
Structure of Escherichia coli K-12 miaA and characterization of the mutator phenotype caused by miaA insertion mutations.
J. Bacteriol. 173(5): 1711-1721.
Medline: 91154127.

Connolly,D.M. and Winkler,M.E. 1989.
Genetic and physiological relationships among the miaA gene, 2-methylthio-N6-(delta 2-isopentenyl)-adenosine tRNA modification, and spontaneous mutagenesis in Escherichia coli K-12.
J. Bacteriol. 171(6): 3233-3246.
Medline: 89255089.

Comment:


Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to tRNA delta-2-isopentylpyrophosphate transferase. Positions 3 to 307 are 73% (E value 1e-131) similar to sp|P44495|MIAA_HAEIN (1170952) tRNA delta-2-isopentylpyrophosphate transferase between positions 2 and 306 in Haemophilus influenzae Rd. Positions 4 to 304 are 68% (E value 1e-118) similar to sp|P16384|MIAA_ECOLI (127087) IPP transferase between positions 10 and 309 in Shigella flexneri. Positions 3 to 293 are 58% (E value 9e-92) similar to sp|O30762|MIAA_PSEPU (6225673) IPP transferase between positions 4 and 303 in Pseudomonas putida.

HD0742 is similar to tRNA isopentenylpyrophosphate transferase from C. trachomatis (CT766), C. pneumoniae (CPn0910), and T. pallidum (TP0637). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0324
COG name: tRNA delta(2)-isopentenylpyrophosphate transferase
Functional Class: J
The phylogenetic pattern of COG0324 is ----yqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002627 (IPP transferase) with a combined E-value of 8.8e-82.
    IPB002627A    31-66
    IPB002627B    89-119
    IPB002627C    147-174
    IPB002627D    204-227
    IPB002627E    269-281


ProDom Summary:  Protein Domain Search
Residues 38-292 are 74% similar to a (TRANSFERASE TRNA ISOPENTENYLTRANSFERASE) protein domain (PD004674) which is seen in MIAA_HAEIN.

Residues 4-37 are 91% similar to a (TRANSFERASE TRNA ISOPENTENYLTRANSFERASE) protein domain (PD023982) which is seen in MIAA_HAEIN.



Paralogs:  Local Blast Search

HD0742 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 38 to 293 (E-value = 6e-142) place HD0742 in the IPPT family which is described as IPP transferase (PF01715)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNKPVAIFLMGPTASGKTDLAIALRKQLPVEVISVDSALIYKEMDIGTAK
PTAAELAQAPHRLIDILDPKESYSAMHFHADALHAMADITASGRIPLLVG
GTMLYYKALLEGLSPLPSANEHIRTEIEAHANQYGWASLHQQLTQIDPLA
ASRINANDSQRINRALEVFYLTGKNLTELTAQQGECLPYQVLQFAIAPQE
RAVLHQRIEQRFHKMMELGFLTEVEKLYARGDLHPDLPAIRCVGYRQMWQ
HLAGEISLDEAIYKGICATRQLAKRQLTWLRGWRSEITWLDSLDPTSSQE
KMIQNLEQNFIKL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAACCTGTTGCAATTTTTTTAATGGGACCGACCGCTTCTGGTAA
AACAGATTTAGCTATCGCATTACGTAAACAACTACCCGTTGAAGTGATTA
GTGTCGATTCTGCCCTCATTTATAAAGAAATGGATATCGGCACAGCTAAA
CCGACTGCGGCGGAACTCGCACAAGCACCGCACCGCTTAATTGATATTTT
AGATCCTAAAGAAAGCTATTCAGCAATGCATTTTCACGCTGACGCATTAC
ACGCAATGGCAGATATTACAGCAAGCGGTCGTATTCCACTCTTAGTAGGT
GGCACTATGCTCTATTACAAAGCGCTACTAGAAGGGCTTTCTCCTTTGCC
ATCTGCCAATGAACATATTCGTACAGAAATTGAAGCTCACGCCAACCAAT
ATGGTTGGGCGAGTTTACATCAACAATTAACCCAAATTGATCCGCTAGCC
GCCAGCAGAATTAATGCAAATGATAGTCAGCGGATCAACCGAGCATTAGA
AGTATTTTATCTGACAGGCAAAAACCTGACTGAATTAACCGCACAACAAG
GTGAATGCTTACCTTATCAAGTTTTACAATTTGCCATTGCTCCGCAAGAA
CGTGCCGTATTACATCAACGTATCGAACAACGTTTTCACAAAATGATGGA
ACTTGGTTTCTTAACTGAGGTCGAAAAGTTATACGCGAGGGGCGATCTAC
ACCCCGACTTACCCGCAATTCGTTGTGTTGGTTACCGTCAAATGTGGCAA
CATTTAGCGGGTGAAATTTCGTTAGATGAAGCAATTTATAAAGGAATTTG
TGCCACCCGCCAATTAGCTAAACGCCAGCTGACGTGGTTACGAGGTTGGC
GGAGTGAAATTACGTGGTTAGACAGTTTAGATCCGACCAGTTCACAAGAA
AAAATGATTCAAAATTTAGAGCAAAACTTCATAAAATTGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy