Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR520 IGR516 IGR513 IGR523 IGR525 IGR522 IGR524 IGR521 IGR519 IGR517 IGR518 IGR515 rpL33, - HD0730 rpL28, - HD0731 hfq, - HD0741 radC, - HD0732 trpX, - HD0742 hflX, - HD0740 dat, - HD0729 ddc, - HD0726 mutL, - HD0743 HD0727 HD0737 ttk, - HD0735 crp, - HD0738 dfp, - HD0733 rpL33, - HD0730 rpL28, - HD0731 hfq, - HD0741 radC, - HD0732 trpX, - HD0742 hflX, - HD0740 dat, - HD0729 ddc, - HD0726 mutL, - HD0743 HD0727 HD0737 ttk, - HD0735 crp, - HD0738 dfp, - HD0733 rpL28, - HD0731 hfq, - HD0741 radC, - HD0732 trpX, - HD0742 hflX, - HD0740 dat, - HD0729 ddc, - HD0726 mutL, - HD0743 rpL33, - HD0730 HD0727 ttk, - HD0735 crp, - HD0738 dfp, - HD0733 dut, - HD0734 dut, - HD0734 HD0737
* Calculated from Protein Sequence

Gene ID: HD0734

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dut  

Definition:
deoxyuridine 5'-triphosphate

Gene Start:
578834

Gene Stop:
579292

Gene Length:
459

Molecular Weight*:
16272

pI*:
5.70

Net Charge*:
-2.29

EC:
3.6.1.23  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Lundberg,L.G., Thoresson,H.O., Karlstrom,O.H. and Nyman,P.O. Nucleotide sequence of the structural gene for dUTPase of Escherichia coli K-12.
EMBO J. 2(6):967-971, 1983.
Medline: 84057777.

Cedergren-Zeppezauer,E.S., Larsson,G., Nyman,P.O., Dauter,Z. and
Wilson,K.S.
Crystal structure of a dUTPase
Nature. 355 (6362), 740-743 (1992)
MEDLINE: 92158084

Larsson,G., Svensson,L.A. and Nyman,P.O.
Crystal structure of the Escherichia coli dUTPase in complex with a substrate analogue (dUDP)
Nature structural biology. 3 (6), 532-538 (1996)
MEDLINE: 96227973

Dauter,Z., Wilson,K.S., Larsson,G., Nyman,P.O. and
Cedergren-Zeppezauer,E.S.
The refined structure of dUTPase from Escherichia coli
Acta Crystallogr. D 54, 735-749 (1998)

Comment:
0

Blast Summary:  PSI-Blast Search
Many significant hits using gapped BLAST to deoxyuridine 5"-triphosphate nucleotidohydrolase (dUTPase). Positions 2 to 152 are 82% (E value 4e-69) similar to sp|P43792|DUT_HAEIN (1169438) deoxyuridine 5"-triphosphate nucleotidohydrolase between positions 1 and 151 in Haemophilus influenzae Rd. Positions 1 to 152 are 70% (E value 2e-61) similar to pdb|1EU5|A (7766857) D-Utpase between positions 1 and 152 in E. coli. Positions 2 to 152 are 70% (E value 2e-61) similar to sp|P06968|DUT_ECOLI (118953) D-Utpase between positions 1 and 151 in E. coli.

HD0734 is similar to deoxyuridine 5"-triphosphate nucleotidohydrolase from C. pneumoniae (CPn0059), C. trachomatis (CT292), and T. pallidum (TP0885). No similarities to U. urealyticum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0756
COG name: dUTPase
Functional Class:  F
The phylogenetic pattern of COG0756 is ----yq--eBrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001428 (dUTPase) with a combined E-value of 3.1e-26.
    IPB001428A    23-33
    IPB001428B    81-99
    IPB001428C    113-124
    IPB001428D    141-150


ProDom Summary:  Protein Domain Search
Residues 87-150 are 85% similar to a (HYDROLASE DUTPASE DEOXYURIDINE NUCLEOTIDOHYDROLASE) protein domain (PD000946) which is seen in DUT_HAEIN.

Residues 14-86 are 87% similar to a (DUTPASE DEOXYURIDINE NUCLEOTIDOHYDROLASE) protein domain (PD068009) which is seen in DUT_PASMU.



Paralogs:  Local Blast Search

HD0734 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 150 (E-value = 1.5e-54) place HD0734 in the dUTPase family which is described as dUTPase (PF00692)

PDB Hit:
pdb|1EU5|A Chain A, Structure Of E. Coli Dutpase At 1.45 A >gi|... 235 3e-063
pdb|1EUW|A Chain A, Atomic Resolution Structure Of E. Coli Dutp... 233 1e-062

Gene Protein Sequence:
MMKHIDLKILDNRIGREFPLPTYATTGSAGLDLRALIDSAITVEAGQTVL
IPTGISVYIADPNLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGPLMVS
IWNRSDKPFTIEVGDRIAQLVFVPVVQASFNIVTDFEQTSRGEGGFGHSG
KQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAACACATTGATTTAAAAATTTTAGATAACCGAATTGGTCGTGA
ATTTCCATTACCGACTTATGCAACTACGGGATCGGCGGGGTTAGATTTAC
GGGCATTAATTGATTCAGCCATTACTGTGGAAGCGGGACAAACCGTATTA
ATTCCTACCGGTATTTCGGTTTATATTGCTGATCCAAACCTTGCTGCGGT
TATTTTACCGCGTTCAGGTTTAGGGCATAAAAATGGTATTGTGTTGGGTA
ATTTAGTGGGGTTAATTGATAGTGATTACCAAGGGCCATTAATGGTTTCT
ATTTGGAATCGCAGTGATAAGCCTTTTACCATTGAAGTAGGCGATAGAAT
TGCACAGTTAGTTTTTGTGCCGGTGGTACAAGCGAGTTTTAATATTGTGA
CTGATTTTGAACAAACTTCACGCGGGGAAGGTGGTTTTGGCCATTCAGGT
AAACAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy