Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR520 IGR516 IGR510 IGR513 IGR519 IGR511 IGR517 IGR518 IGR512 IGR509 IGR515 rpL33, - HD0730 rpL28, - HD0731 HD0725 radC, - HD0732 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 HD0727 HD0737 ttk, - HD0735 corA, - HD0721 dfp, - HD0733 rpL33, - HD0730 rpL28, - HD0731 HD0725 radC, - HD0732 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 HD0727 HD0737 ttk, - HD0735 corA, - HD0721 dfp, - HD0733 rpL28, - HD0731 HD0725 radC, - HD0732 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 rpL33, - HD0730 HD0727 ttk, - HD0735 corA, - HD0721 dfp, - HD0733 dut, - HD0734 dut, - HD0734 HD0737
* Calculated from Protein Sequence

Gene ID: HD0729

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dat  

Definition:
diaminobutyrate--2-oxoglutarate aminotransferase

Gene Start:
575813

Gene Stop:
574449

Gene Length:
1365

Molecular Weight*:
49208

pI*:
7.00

Net Charge*:
0.00

EC:
2.6.1.76  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table

Secondary Evidence:
Ikai,H. and Yamamoto,S.
Identification and analysis of a gene encoding L-2,4-diaminobutyrate:2-ketoglutarate 4-aminotransferase involved in the 1,3-diaminopropane production pathway in Acinetobacter baumannii.
J. Bacteriol. 179(16):5118-5125, 1997.
Medline: 97405910.


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to diaminobutyrate--2-oxoglutarate aminotransferases.Residues 1-453 are 84% similar to the enzyme from H.influenzae (1175339|) and residues 1-454 are 64% similar to the enzyme from Acinetobacter baumannii (6685373|).

HD0729 is similar to glutamate-1-semialdehyde 2,1-aminomutase from C. pneumoniae (CPn0138) and C. trachomatis (CT210), and to Adenosylmethionine-8-Amino-7-Oxononanoate Aminotransferase (CPn1041). No similarities to U. urealyticum, T. pallidum, M. genitalium, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0160
COG name: PLP-dependent aminotransferases
Functional Class: E
The phylogenetic pattern of COG0160 is AmtKYqvcEBRh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000954 (Aminotransferase class-III pyridoxal-phosphate) with a combined E-value of 1.5e-52.
    IPB000954A    49-78
    IPB000954B    229-268
    IPB000954C    277-292
    IPB000954D    312-330


ProDom Summary:  Protein Domain Search
Residues 227-283 are 50% similar to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD000465) which is seen in Q9HHV4_HALN1.

Residues 221-386 are 29% similar to a (TRANSFERASE 6-AMINOTRANSFERASE L-LYSINE) protein domain (PD308202) which is seen in Q9EVJ7_BBBBB.

Residues 132-371 are 91% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in DAT_HAEIN.

Residues 33-69 are identical to a (AMINOTRANSFERASE PYRIDOXAL PHOSPHATE PROTEOME COMPLETE) protein domain (PD000493) which is seen in DAT_HAEIN.

Residues 220-304 are 41% similar to a (PHOSPHOPANTETHEINE) protein domain (PD336190) which is seen in Q9RNB3_MICAE.

Residues 305-371 are 44% similar to a (AMINOTRANSFERASE PYRIDOXAL TRANSAMINASE PHOSPHATE GABA) protein domain (PD098527) which is seen in Q9HHV4_HALN1.

Residues 70-131 are 75% similar to a (AMINOTRANSFERASE TRANSAMINASE PHOSPHATE) protein domain (PD187688) which is seen in DAT_HAEIN.



Paralogs:  Local Blast Search
HD0729 is paralogously related to HD0892 (3e-35) and HD1685 (5e-26).


Pfam Summary:  Pfam Search
Residues 26 to 449 (E-value = 2.7e-203) place HD0729 in the Aminotran_3 family which is described as Aminotransferase class-III (PF00202)

PDB Hit:
pdb|1D7U|A Chain A, Crystal Structure Of The Complex Of 2,2-Dia... 166 4e-042
pdb|1DGD| Dialkylglycine Decarboxylase (Pyruvate) (Dgd) (E.C... 166 4e-042
pdb|2DKB| 2,2-Dialkylglycine Decarboxylase (Pyruvate) (Dgd) ... 162 1e-040

Gene Protein Sequence:
MTITTPIKAVLASNQHFLDRQDKMESNVRSYPRKLPFAYAKAQGCWVTDV
EGNEYLDFLAGAGTLALGHNHPILMQSIKDVLDSGLPLHTLDLTTPLKDA
FTEELLSFFPKDEYILQFTGPSGADANEAAIKLAKTYTNRGNIIAFSGGF
HGMTHGALSLTGNLGAKNAVQNLMPGVQFMPYPHEYRCPFGIGGEAGAKA
VERYFENFIEDIESGVVKPAAVILEAIQGEGGMVPAPISFLQKVREVTQK
HGILMIVDEVQAGFCRSGKMFAFEHAGIAPDIVVMSKAIGGSLPLAVLAI
KKQFDAWQPAGHTGTFRGNQLAMATGYASLKIMRQENLAQNAQARGEYLT
NALRELSKTFACIGNVRGKGLMMGIDIVDERQAQDATGAYPQDCELAIAI
QKCCFNNKLLLERGGRGGNVVRVLCPVNINQAECEEFIKRFTQSVADAIK
AVRG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAATTACTACTCCTATTAAGGCGGTTCTTGCCTCCAACCAACATTT
CTTAGATCGCCAAGATAAAATGGAATCTAATGTACGCAGTTATCCACGTA
AACTGCCATTTGCATATGCCAAAGCACAAGGATGTTGGGTTACAGACGTT
GAAGGAAATGAATATCTTGACTTTTTGGCAGGTGCAGGAACATTAGCATT
AGGCCATAATCATCCGATACTAATGCAATCTATCAAAGATGTATTAGATA
GCGGTTTACCATTACATACTCTTGATTTAACTACGCCATTAAAAGATGCC
TTTACAGAAGAATTACTATCTTTTTTCCCTAAAGATGAATACATTCTACA
GTTCACCGGTCCATCAGGTGCCGATGCCAATGAAGCGGCCATTAAATTAG
CCAAAACTTACACAAACCGAGGAAATATTATCGCTTTTTCCGGAGGTTTC
CACGGCATGACGCACGGTGCATTATCTTTAACCGGTAATCTTGGCGCTAA
AAATGCGGTACAAAACCTAATGCCAGGCGTGCAATTCATGCCTTATCCAC
ACGAATATCGTTGTCCATTTGGTATTGGCGGTGAAGCGGGTGCAAAAGCT
GTTGAACGCTATTTTGAAAACTTTATTGAAGATATTGAAAGTGGCGTAGT
TAAACCGGCAGCGGTGATCTTAGAAGCCATTCAAGGCGAAGGTGGAATGG
TGCCAGCACCGATCAGTTTCTTACAAAAAGTCCGTGAAGTAACTCAAAAA
CACGGCATATTAATGATTGTAGATGAAGTCCAAGCAGGTTTCTGCCGTTC
AGGAAAAATGTTTGCTTTCGAACACGCAGGCATTGCACCAGATATTGTGG
TTATGTCAAAAGCCATCGGTGGAAGCCTACCATTAGCCGTCTTAGCGATC
AAAAAACAATTTGATGCTTGGCAGCCTGCTGGCCATACAGGCACATTCCG
CGGTAATCAGCTAGCTATGGCAACTGGCTATGCCTCATTAAAAATTATGC
GACAAGAAAACCTAGCGCAGAATGCACAGGCACGTGGTGAATACTTAACC
AATGCCTTACGTGAATTAAGTAAAACATTTGCTTGTATTGGTAATGTACG
TGGTAAAGGTTTGATGATGGGTATCGATATTGTTGATGAACGTCAAGCAC
AAGATGCCACGGGCGCTTATCCACAAGATTGTGAATTAGCTATTGCGATC
CAAAAATGCTGCTTTAATAACAAATTATTACTAGAACGTGGCGGTCGTGG
TGGTAATGTAGTCAGAGTCCTTTGCCCAGTAAATATTAATCAAGCAGAAT
GTGAAGAATTTATCAAACGTTTCACACAATCAGTCGCTGATGCAATTAAG
GCGGTTAGAGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy