Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR507 IGR516 IGR510 IGR506 IGR513 IGR511 IGR517 IGR508 IGR518 IGR512 IGR509 IGR515 HD0720 rpL33, - HD0730 rpL28, - HD0731 HD0725 HD0718 radC, - HD0732 ubiE, - HD0719 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 HD0727 corA, - HD0721 dfp, - HD0733 HD0720 rpL33, - HD0730 rpL28, - HD0731 HD0725 HD0718 radC, - HD0732 ubiE, - HD0719 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 HD0727 corA, - HD0721 dfp, - HD0733 rpL28, - HD0731 HD0725 radC, - HD0732 ubiE, - HD0719 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 HD0720 rpL33, - HD0730 HD0718 HD0727 corA, - HD0721 dfp, - HD0733
* Calculated from Protein Sequence

Gene ID: HD0726

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ddc  

Definition:
L-2,4-diaminobutyrate decarboxylase

Gene Start:
574292

Gene Stop:
572757

Gene Length:
1536

Molecular Weight*:
56119

pI*:
5.70

Net Charge*:
-12.12

EC:
4.1.1.-  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  
Other categories; Other  

Pathway: pathway table
1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
Alkaloid biosynthesis I
Aminophosphonate metabolism
Arginine and proline metabolism
Ascorbate and aldarate metabolism
Flavonoids, stilbene and lignin biosynthesis
Phenylalanine metabolism
Purine metabolism
Pyruvate metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis
Vitamin B6 metabolism

Secondary Evidence:
Yamamoto S, Mutoh N, Tsuzuki D, Ikai H, Nakao H, Shinoda S, Narimatsu S, Miyoshi SI.
Cloning and characterization of the ddc homolog encoding L-2,4-diaminobutyrate decarboxylase in Enterobacter aerogenes.
Biol Pharm Bull. 2000 May;23(5):649-53.
PMID: 10823682

Ikai H, Yamamoto S.
Two genes involved in the 1,3-diaminopropane production pathway in Haemophilus influenzae.
Biol Pharm Bull. 1998 Feb;21(2):170-3.
PMID: 9514614

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to (in descending order) L-2,4-diaminobutyrate decarboxylases; cysteine sulfinic acid decarboxylases; and glutamate,tryptophan, and tyrosine decarboxylases. Residues 1-511 are 79% similar to DDC_HAEIN [6685375], residues 1-511 are 71% similar to DDC_ACIBA [6685376], and residues 11-497 are 49% similar to the sequence for L-2,4-diaminobutyrate decarboxylase in Enterobacter aerogenes [5917596].

COGS Summary:  COGS Search
BeTs to 5 clades of COG0076
COG name: Glutamate decarboxylase and related PLP-dependent proteins
Functional Class: E
The phylogenetic pattern of COG0076 is AMtkY--cE-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 148-216 are 46% similar to a (PROTEOME COMPLETE L-24-DIAMINOBUTYRATE) protein domain (PD412700) which is seen in Q9K9M2_BACHD.

Residues 150-369 are 35% similar to a (AMINOTRANSFERASE PHOSPHATE PYRIDOXAL COMPLETE PROTEOME) protein domain (PD000087) which is seen in RHSB_RHIME.

Residues 193-297 are 65% similar to a (DECARBOXYLASE LYASE PYRIDOXAL PHOSPHATE ACID GLUTAMIC) protein domain (PD407440) which is seen in DDC_HAEIN.

Residues 298-369 are 93% similar to a (DECARBOXYLASE LYASE PHOSPHATE PYRIDOXAL ACID GLUTAMIC) protein domain (PD004619) which is seen in DDC_HAEIN.

Residues 370-498 are 83% similar to a (DECARBOXYLASE LYASE PHOSPHATE PYRIDOXAL CATECHOLAMINE) protein domain (PD036393) which is seen in DDC_HAEIN.

Residues 145-191 are 82% similar to a (DECARBOXYLASE DABA-DC LYASE 4.1.1.-) protein domain (PD410975) which is seen in DDC_HAEIN.

Residues 14-143 are 83% similar to a (DECARBOXYLASE L-24-DIAMINOBUTYRATE LYASE) protein domain (PD037863) which is seen in DDC_HAEIN.



Paralogs:  Local Blast Search
HD0726 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 60 to 430 (E-value = 1.7e-32) place HD0726 in the Pyridoxal_deC family which is described as Pyridoxal-dependent decarboxylase conserved domain (PF00282)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTDISKHRQALFCSDAQSIADYQNAMNNAVLAVSEWLKNDKMYTGGSIKQ
MRTLIDGFNPSKNGVGVQKSLEKLVEIFLNPSLKVHHPHSLAHLHCPTMV
TSQIAEVLINATNQSMDSWDQSPAGSIMEEHLIDWLRHKVGYGQGTAGVF
TSGGTQSNLMGVLLARDWAIAKHWQHDDGTEWSVQANGIPAAAMQTVKVV
CSENAHFSVQKNMAMMGMGFQSVVTVPSNANAQMDLDALAKTLADLKASG
NIVACIVATAGTTDAGAIDDLTAIRKLADEYQAWLHVDAAWGGALLLSKD
FRHFLNGIELTDSITLDFHKHFFQSISCGAFLLKDPANYRFIDYKADYLN
SEYDEAHGVPNLVAKSLQTTRRFDALKLWFTIDALGENLYASMIDHGVYL
SRQVEAYINATYNLEMLVPAQFASVLFRVVPKGYPQELIDTLNQNVADEL
FARGEANIGVTKVADKQSLKMTTLSPIATFENVKALLEQVLAEAERIKDA
IAQGTYVPPID$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGATATTTCAAAACATAGGCAGGCTCTTTTCTGTAGTGATGCCCA
ATCTATTGCAGATTATCAAAATGCAATGAATAACGCAGTGTTAGCCGTAA
GTGAGTGGTTAAAAAACGATAAAATGTATACGGGCGGTTCAATCAAACAA
ATGCGTACACTAATTGATGGTTTTAATCCGTCAAAAAATGGGGTTGGTGT
GCAGAAATCGCTAGAGAAGTTGGTAGAAATTTTCTTAAATCCAAGCTTAA
AAGTCCATCACCCCCATTCACTTGCTCACTTGCACTGTCCAACAATGGTT
ACCAGCCAAATTGCCGAAGTATTGATTAATGCCACTAATCAATCAATGGA
TTCTTGGGATCAAAGTCCAGCCGGATCGATTATGGAAGAACATTTAATTG
ATTGGTTACGTCATAAAGTTGGTTATGGTCAAGGCACTGCTGGCGTTTTT
ACATCAGGTGGCACACAGTCAAATTTAATGGGCGTTCTATTAGCACGCGA
TTGGGCAATTGCTAAACATTGGCAACATGATGATGGTACAGAATGGTCAG
TGCAAGCGAACGGTATCCCCGCGGCTGCAATGCAAACCGTTAAAGTAGTA
TGTTCTGAAAATGCACATTTTTCTGTGCAAAAAAATATGGCCATGATGGG
AATGGGTTTCCAATCAGTTGTAACGGTACCATCTAATGCCAATGCCCAAA
TGGATCTCGACGCGTTAGCCAAAACATTAGCTGATTTAAAAGCCTCAGGC
AATATTGTCGCGTGTATCGTTGCTACTGCAGGCACTACAGATGCAGGTGC
AATTGATGATTTAACCGCTATTCGCAAACTCGCAGATGAATACCAAGCGT
GGCTACACGTTGACGCTGCTTGGGGCGGTGCTTTACTATTATCTAAAGAT
TTCCGCCACTTCTTAAATGGCATTGAATTAACTGATTCGATTACCCTCGA
TTTTCATAAACACTTCTTCCAAAGTATCTCATGTGGCGCATTCTTACTTA
AAGATCCAGCAAATTATCGCTTCATTGATTATAAAGCAGACTATTTAAAT
TCAGAGTATGATGAAGCCCACGGCGTGCCAAACCTAGTCGCAAAATCATT
GCAAACGACTCGTCGTTTTGATGCGCTAAAATTATGGTTCACCATAGATG
CATTAGGTGAAAATTTATATGCCTCTATGATTGATCACGGCGTTTATTTA
TCTCGACAAGTTGAAGCATATATCAATGCAACATATAACTTAGAAATGCT
TGTTCCTGCACAATTTGCATCAGTATTATTCCGAGTGGTGCCAAAAGGCT
ATCCGCAAGAATTAATTGATACTTTAAACCAAAATGTGGCTGATGAATTA
TTCGCGCGTGGTGAAGCAAATATTGGCGTAACTAAGGTAGCTGATAAGCA
ATCACTCAAAATGACGACATTGAGTCCAATTGCTACTTTTGAAAATGTTA
AAGCATTATTAGAGCAAGTCTTAGCCGAAGCAGAACGGATTAAAGATGCC
ATTGCACAAGGTACTTATGTACCACCGATCGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy