Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR507 IGR516 IGR510 IGR506 IGR513 IGR511 IGR508 IGR512 IGR509 IGR515 HD0720 rpL33, - HD0730 rpL28, - HD0731 HD0725 ubiE, - HD0719 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 ubiB, - HD0717 HD0727 corA, - HD0721 HD0720 rpL33, - HD0730 rpL28, - HD0731 HD0725 ubiE, - HD0719 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 ubiB, - HD0717 HD0727 corA, - HD0721 rpL28, - HD0731 HD0725 ubiE, - HD0719 trmA, - HD0723 dat, - HD0729 ddc, - HD0726 ubiB, - HD0717 HD0718 HD0718 HD0720 rpL33, - HD0730 HD0727 corA, - HD0721
* Calculated from Protein Sequence

Gene ID: HD0723

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
trmA  

Definition:
tRNA (uracil-5-)-methyltransferase (tRNA(M-5-U54)-methyltransferase)

Gene Start:
572088

Gene Stop:
570979

Gene Length:
1110

Molecular Weight*:
42170

pI*:
8.00

Net Charge*:
4.13

EC:
2.1.1.35  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Gustafsson,C., Lindstrom,P.H., Hagervall,T.G., Esberg,K.B. and
Bjork,G.R.
The trmA promoter has regulatory features and sequence elements in
common with the rRNA P1 promoter family of Escherichia coli
J. Bacteriol. 173 (5), 1757-1764 (1991)
Medline: 91154132

Gustafsson,C. and Warne,S.R.
Physical map of the oxyR-trmA region (minute 89.3) of the
Escherichia coli chromosome
J. Bacteriol. 174 (23), 7878-7879 (1992)
Medline: 93077482



Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to tRNA (uracil-5-)-methyltransferase proteins; e.g., residues 16-384 are 67% similar to TRMA_HAEIN [1174775], residues 18-384 are 63% similar to TRMA_ECOLI [136247], and residues 21-384 are 57% similar to the sequence for tRNA (uracil-5-)-methyltransferase in Vibrio cholerae [9654556].

COGS Summary:  COGS Search
BeTs to 9 clades of COG2265
COG name: SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase
Functional Class: J
The phylogenetic pattern of COG2265 is am-kYqvCEBrhuj-------
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB001566 (RNA methyltransferase trmA family) with a combined E-value of 7.3e-50.
    IPB001566A    217-258
    IPB001566B    299-309
    IPB001566C    322-331
    IPB001566D    343-366


ProDom Summary:  Protein Domain Search
Residues 8-205 are 41% similar to a (METHYLTRANSFERASE PROTEOME RNA COMPLETE 2.1.1.-) protein domain (PD007501) which is seen in Q9RHS9_PSEFL.

Residues 321-368 are 77% similar to a (METHYLTRANSFERASE COMPLETE PROTEOME RNA TRNA) protein domain (PD004091) which is seen in Q9CK32_PASMU.

Residues 174-265 are 72% similar to a (METHYLTRANSFERASE TRNA) protein domain (PD035416) which is seen in TRMA_HAEIN.

Residues 12-145 are 58% similar to a (TRNA METHYLTRANSFERASE) protein domain (PD033737) which is seen in TRMA_HAEIN.

Residues 268-319 are 78% similar to a (METHYLTRANSFERASE TRNA) protein domain (PD338239) which is seen in Q9CK32_PASMU.

Residues 217-267 are 78% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE TRNA) protein domain (PD292646) which is seen in TRMA_ECOLI.



Paralogs:  Local Blast Search

HD0723 is paralogously related to HD1765 (3e-16) and HD0478 (2e-12).


Pfam Summary:  Pfam Search
Residues 7 to 369 (E-value = 3e-246) place HD0723 in the tRNA_U5-meth_tr family which is described as tRNA (Uracil-5-)-methyltransferase (PF05958)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VSLPIEQYPELLAQKVDNLTALLAPFNPPPFDIFASETSHFRMRAEFRVW
HQKNEQGENDLYHIMFDPTTKQRYRVDQLPIANQLINTMMQKLLTQIQGI
PVLTHKLFQVDYLTTLSGEIAISLLYHKKLTDEWLAQAKLLKQRLSEPGL
TVHIIGRASKQKIAIDCDYVKEKLNVAGKTLIYRQVENSFTQPNAKMNIN
MLEWAQKCTANSQDSDLLELYCGNGNFSIALAGNFRKVLATEICKSSVHS
AQYNIAQNGIDNLQIIRMSAEEFTQAINGVRQFNRLQGIDLSAYQCNTIF
VDPPRAGLDQATLNMVQNYPRILYISCNPATLADNLRQLTTTHRIERVAL
FDQFPYTHHIESGVWLIRK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGCCTTCCTATCGAGCAATACCCTGAATTACTCGCCCAAAAAGTCGA
TAATCTGACCGCGTTACTAGCACCCTTTAATCCACCACCCTTTGATATCT
TTGCATCAGAAACTAGCCACTTTCGTATGCGGGCAGAATTTCGTGTTTGG
CACCAAAAAAATGAACAAGGCGAAAATGATCTCTATCATATTATGTTCGA
TCCAACGACCAAACAACGCTATCGCGTTGATCAATTGCCCATTGCAAATC
AGTTGATCAATACCATGATGCAAAAACTGCTGACTCAGATTCAAGGCATC
CCAGTACTGACACATAAACTATTTCAAGTTGACTACTTAACCACCTTAAG
CGGTGAAATAGCCATCTCCCTCCTCTATCACAAAAAATTAACGGATGAAT
GGCTTGCGCAAGCAAAATTACTCAAACAACGTTTAAGTGAACCCGGCTTA
ACCGTGCACATTATTGGCCGTGCTAGCAAACAAAAAATTGCAATAGATTG
TGATTATGTCAAAGAAAAATTAAATGTCGCAGGTAAAACATTAATTTACC
GTCAGGTAGAAAATAGTTTTACCCAGCCAAATGCCAAAATGAACATTAAT
ATGCTTGAGTGGGCACAAAAATGTACCGCAAATAGCCAAGATAGTGATTT
ATTAGAATTATATTGTGGAAATGGCAACTTCTCCATTGCATTAGCGGGCA
ATTTTCGCAAAGTACTCGCAACGGAAATTTGCAAATCGTCAGTTCATTCC
GCCCAATATAATATTGCACAAAATGGCATCGATAATCTGCAAATTATTCG
AATGTCGGCAGAAGAATTTACTCAAGCAATCAATGGCGTGCGTCAATTTA
ACCGCTTGCAAGGCATTGACTTAAGCGCATATCAATGTAATACGATCTTC
GTTGATCCTCCTCGTGCAGGTTTAGACCAAGCAACACTCAATATGGTGCA
AAACTATCCACGAATTTTATATATTTCCTGTAATCCGGCTACACTGGCGG
ACAATTTACGGCAATTAACGACAACACACCGAATTGAACGTGTGGCGCTT
TTTGATCAATTCCCTTATACCCATCATATAGAAAGCGGAGTTTGGTTGAT
CAGGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy