Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR504 IGR507 IGR510 IGR506 IGR502 IGR503 IGR511 IGR505 IGR508 IGR512 IGR509 HD0720 tatA, - HD0716 HD0725 HD0713 tatC, - HD0714 ubiE, - HD0719 trmA, - HD0723 ddc, - HD0726 ubiB, - HD0717 fpg,mutM, - HD0710 corA, - HD0721 HD0720 tatA, - HD0716 HD0725 HD0713 tatC, - HD0714 ubiE, - HD0719 trmA, - HD0723 ddc, - HD0726 ubiB, - HD0717 fpg,mutM, - HD0710 corA, - HD0721 HD0725 HD0713 tatC, - HD0714 ubiE, - HD0719 trmA, - HD0723 ddc, - HD0726 ubiB, - HD0717 tatB, - HD0715 HD0718 HD0718 tatA, - HD0716 HD0720 tatB, - HD0715 fpg,mutM, - HD0710 corA, - HD0721
* Calculated from Protein Sequence

Gene ID: HD0719

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ubiE  

Definition:
ubiquinone/menaquinone biosynthesis

Gene Start:
569428

Gene Stop:
568649

Gene Length:
780

Molecular Weight*:
29017

pI*:
9.10

Net Charge*:
4.59

EC:
2.1.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ubiquinone/menaquinone biosynthesis methyltransferase proteins; e.g., residues 24-272 are 77% similar to UBIE_ECOLI [2851439], residues 20-272 are 75% similar to the sequence for ubiquinone/menaquinone biosynthesis methyltransferase ubiE in Vibrio cholerae [9654480], and residues 26-271 are 67% similar to the sequence for ubiquinone biosynthesis methyltransferase ubiE in Pseudomonas aeruginosa [9951355].

COGS Summary:  COGS Search
BeTs to 9 clades of COG2226
COG name: Methylase involved in ubiquinone/menaquinone biosynthesis UbiE/COQ5
Functional Class: H
The phylogenetic pattern of COG2226 is ----yqvcebr-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000339 (ubiE/COQ5 methyltransferase family) with a combined E-value of 6.4e-105.
    IPB000339A    33-60
    IPB000339B    74-88
    IPB000339C    98-115
    IPB000339D    139-181
    IPB000339E    191-221
    IPB000339F    236-258


ProDom Summary:  Protein Domain Search
Residues 30-145 are 85% similar to a (METHYLTRANSFERASE BIOSYNTHESIS PROTEOME COMPLETE) protein domain (PD006106) which is seen in Q9CKD6_PASMU.

Residues 148-258 are 85% similar to a (METHYLTRANSFERASE BIOSYNTHESIS UBIQUINONE PROTEOME) protein domain (PD008172) which is seen in Q9CKD6_PASMU.

Residues 7-60 are 61% similar to a (METHYLTRANSFERASE UBIQUINONE BIOSYNTHESIS) protein domain (PD074454) which is seen in COQ5_YEAST.

Residues 147-209 are 44% similar to a (METHYLTRANSFERASE UBIQUINONE BIOSYNTHESIS) protein domain (PD135199) which is seen in YOY9_CAEEL.



Paralogs:  Local Blast Search
HD0719 is paralogously related to HD1261 (9e-05) and HD1681 (3e-04).


Pfam Summary:  Pfam Search
Residues 22 to 258 (E-value = 2.3e-149) place HD0719 in the Ubie_methyltran family which is described as ubiE/COQ5 methyltransferase family (PF01209)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIKDTQSTAENQANETTHFGFKTVAKEEKQQLVANVFHSVAAKYDLMNDL
LSFGIHRIWKRFTIDCSGVRKGQKVLDLAGGTGDFSAKFSRIVGETGQVV
LADINSSMLEVGRDKLRNLGVVGNINYVQANAEHLPFADNTFDCVVISFG
LRNVTDKDKALKSMYRVLKPGGRLLVLEFSKPIFDPISQLYNFYSFNILP
KVGGIVVNDAESYRYLAESIRMHPKQDELKTMMEHAGFESVNYYNLSAGI
VALHRGYKF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAAAAGATACACAATCTACTGCTGAAAATCAGGCAAATGAAACCAC
CCATTTTGGTTTTAAAACGGTTGCGAAAGAAGAAAAACAGCAATTAGTCG
CCAATGTCTTCCATAGCGTTGCCGCTAAATACGATCTGATGAATGATTTA
CTCTCCTTTGGTATTCATCGCATTTGGAAACGCTTTACCATTGATTGCAG
TGGCGTACGTAAAGGGCAAAAAGTGCTAGACTTAGCCGGTGGTACCGGTG
ATTTTAGTGCAAAATTTTCGCGGATTGTTGGCGAAACAGGGCAAGTGGTT
CTAGCGGATATCAATAGCTCAATGTTAGAAGTGGGACGCGATAAATTACG
CAATTTAGGCGTGGTAGGTAATATTAATTATGTACAAGCCAATGCTGAAC
ATTTACCTTTTGCTGATAATACTTTCGATTGTGTGGTGATCAGTTTCGGC
TTACGCAATGTGACAGACAAAGATAAAGCATTAAAATCAATGTATCGCGT
CTTAAAGCCAGGCGGTCGTTTATTAGTCTTAGAATTTTCCAAGCCGATTT
TTGACCCCATCAGCCAACTATATAATTTTTATTCTTTCAATATCTTACCT
AAAGTCGGCGGGATTGTCGTGAATGATGCGGAAAGTTATCGTTATCTAGC
AGAATCGATTCGTATGCATCCTAAACAAGATGAATTAAAAACAATGATGG
AACATGCGGGGTTTGAGAGTGTTAATTATTACAATTTGAGTGCTGGGATT
GTCGCCTTACACCGTGGCTATAAATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy