Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR504 IGR507 IGR506 IGR501 IGR499 IGR502 IGR503 IGR505 IGR498 IGR500 HD0720 tatA, - HD0716 HD0713 tatC, - HD0714 ubiE, - HD0719 ubiB, - HD0717 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 braB,brnQ, - HD0709 HD0720 tatA, - HD0716 HD0713 tatC, - HD0714 ubiE, - HD0719 ubiB, - HD0717 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 braB,brnQ, - HD0709 Type: tandem, Name:  - 11 HD0713 tatC, - HD0714 ubiE, - HD0719 ubiB, - HD0717 tatB, - HD0715 HD0718 HD0718 tatA, - HD0716 HD0720 tatB, - HD0715 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 braB,brnQ, - HD0709
* Calculated from Protein Sequence

Gene ID: HD0713

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (possible dnaJ-family protein)

Gene Start:
564703

Gene Stop:
564341

Gene Length:
363

Molecular Weight*:
13786

pI*:
9.90

Net Charge*:
4.12

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 15-119 are 37% similar to 22985728 hypothetical protein [Burkholderia fungorum]. Otherwise, two significant hits in gapped BLAST: residues 9-118 are 39% similar to residues 121-239 of the sequence of a putative dnaJ-family protein in Neisseria meningitidis [7380111], and residues 7-103 are 34% similar to the sequence for hypothetical protein RP798 in Rickettsia prowazekii [7467856].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0713 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNDPSLLNSNNNAKRKMMYFIYALFGLGMVFGGLPTLVGVILAYIKRDEM
IGTLYYDHLCFLIKTFWGTVILCGLGFLLTMIFIGVFLIWAVGIWYIFRI
IYGAVRFFDNKPVTPTGWFM$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGATCCTTCTTTACTGAATTCTAATAATAATGCAAAACGAAAAAT
GATGTATTTCATTTATGCTTTATTTGGTTTAGGCATGGTTTTTGGTGGTC
TTCCCACTCTTGTAGGCGTAATCTTGGCTTATATTAAACGAGATGAAATG
ATCGGCACACTTTACTATGATCACTTATGTTTCTTAATTAAAACCTTTTG
GGGTACCGTAATTTTATGCGGATTAGGCTTCCTATTAACTATGATCTTCA
TAGGTGTTTTTCTGATTTGGGCAGTAGGTATTTGGTATATTTTCAGAATC
ATCTATGGCGCGGTTAGATTCTTTGATAATAAACCGGTTACGCCAACAGG
TTGGTTTATGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy