Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR504 IGR506 IGR501 IGR497 IGR499 IGR502 IGR503 IGR505 IGR498 IGR500 tatA, - HD0716 HD0713 tatC, - HD0714 ubiE, - HD0719 ubiB, - HD0717 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 tatA, - HD0716 HD0713 tatC, - HD0714 ubiE, - HD0719 ubiB, - HD0717 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 Type: tandem, Name:  - 11 HD0713 tatC, - HD0714 ubiB, - HD0717 tatB, - HD0715 HD0718 tatA, - HD0716 ubiE, - HD0719 tatB, - HD0715 HD0718 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709
* Calculated from Protein Sequence

Gene ID: HD0710

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fpg  mutM  

Definition:
formamidopyrimidine-DNA glycosylase (fpg)

Gene Start:
563451

Gene Stop:
564275

Gene Length:
825

Molecular Weight*:
30429

pI*:
9.00

Net Charge*:
7.87

EC:
3.2.2.23  

Functional Class:
DNA metabolism; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Boiteux,S., O"Connor,T.R. and Laval,J.
Formamidopyrimidine-DNA glycosylase of Escherichia coli: cloning
and sequencing of the fpg structural gene and overproduction of the protein
EMBO J. 6 (10), 3177-3183 (1987)
Medline: 88082692

Clementz,T. and Raetz,C.R.
A gene coding for 3-deoxy-D-manno-octulosonic-acid transferase in
Escherichia coli. Identification, mapping, cloning, and sequencing
J. Biol. Chem. 266 (15), 9687-9696 (1991)
Medline: 91236744

O"Connor,T.R., Graves,R.J., de Murcia,G., Castaing,B. and Laval,J.
Fpg protein of Escherichia coli is a zinc finger protein whose
cysteine residues have a structural and/or functional role
J. Biol. Chem. 268 (12), 9063-9070 (1993)
Medline: 93232071

Duwat P, de Oliveira R, Ehrlich SD, Boiteux S
Repair of oxidative DNA damage in gram-positive bacteria: the Lactococcus lactis Fpg protein.
Microbiology 1995 Feb;141 ( Pt 2):411-7
PMID: 7704272

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to formamidopyrimidine-DNA glycosylases; e.g., residues 1-270 are 60% similar to FPG_HAEIN [1169727], residues 1-270 are 57% similar to FPG_ECOLI [120475], and residues 1-270 are 57% similar to FPG_SALTY [6016042].

COGS Summary:  COGS Search
BeTs to 5 clades of COG0266
COG name: Formamidopyrimidine-DNA glycosylase
Functional Class: L
The phylogenetic pattern of COG0266 is -------cEbRh--gp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000214 (Formamidopyrimidine-DNA glycolase, zinc binding domain) with a combined E-value of 3.4e-62.
    IPB000214A    1-13
    IPB000214B    54-78
    IPB000214C    105-114
    IPB000214D    160-185
    IPB000214E    239-270


ProDom Summary:  Protein Domain Search
Residues 1-270 are 60% similar to a (GLYCOSYLASE GLYCOSIDASE FORMAMIDOPYRIMIDINE-DNA) protein domain (PD003680) which is seen in FPG_HAEIN.



Paralogs:  Local Blast Search
HD0710 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 119 (E-value = 4.5e-43) place HD0710 in the Fapy_DNA_glyco family which is described as Formamidopyrimidine-DNA glycosylase N-terminal domain (PF01149)
Residues 131 to 223 (E-value = 1.5e-39) place HD0710 in the H2TH family which is described as Formamidopyrimidine-DNA glycosylase H2TH domain (PF06831)

PDB Hit:
pdb1EE8A Chain A, Crystal Structure Of Mutm (Fpg) Protein Fro... 179 3e-046

Gene Protein Sequence:
MPELPEVETCLRGIEPYLAGQTIQQIVIRTPKLRWPISAELCAMSGAKIL
ALSRRAKYLIIHTERGDILVHLGMSGSLTLLNSSQPTKASKHDHVDLITE
AGIILRYNDPRKFGAWLWAKQAENYPLITKLGPEPLSDTFTSDYLFKKSR
NKTVAVKNFIMNNDIVVGVGNIYASESLFMAGVHPELAAQNLTEKQCVQL
RNVIQAVLTKAIIQGGTTLKDFTQPDGKPGYFAQVLQVYGRKGEECRECG
TLIQAKVIGQRNSYFCPDCQPLPK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAGAATTACCAGAAGTCGAAACGTGCCTACGCGGTATCGAGCCTTA
TTTAGCAGGGCAAACTATTCAGCAGATTGTAATACGTACACCAAAGTTAC
GTTGGCCAATTTCTGCTGAATTATGTGCGATGTCAGGCGCAAAAATTTTG
GCACTATCTCGCCGTGCAAAATATTTAATTATACACACTGAACGCGGTGA
TATTTTGGTACATCTTGGTATGTCAGGCTCACTCACCCTTCTGAATTCAT
CTCAACCAACAAAAGCAAGCAAACACGACCATGTTGATTTGATTACAGAA
GCAGGCATCATTTTACGTTACAATGACCCACGTAAATTTGGTGCTTGGTT
ATGGGCTAAACAAGCGGAAAATTATCCACTGATCACAAAATTAGGCCCTG
AGCCTCTTTCGGATACTTTTACAAGCGATTATTTATTCAAAAAAAGTCGT
AACAAAACCGTCGCGGTAAAAAATTTTATTATGAACAACGATATTGTTGT
TGGTGTGGGAAATATTTATGCCTCTGAATCGCTTTTTATGGCGGGGGTTC
ATCCTGAATTAGCGGCACAAAATCTAACTGAAAAACAATGTGTACAGTTA
AGGAATGTGATTCAAGCCGTATTAACCAAAGCGATTATTCAAGGTGGCAC
CACATTAAAAGATTTTACTCAACCAGACGGTAAACCAGGCTATTTTGCGC
AAGTGCTACAAGTATATGGTAGGAAAGGTGAGGAATGTCGAGAATGTGGT
ACGCTCATTCAAGCCAAAGTGATTGGGCAACGCAACAGTTATTTTTGCCC
TGATTGTCAGCCGTTGCCTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy