Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR504 IGR496 IGR501 IGR497 IGR499 IGR502 IGR503 IGR495 IGR505 IGR498 IGR500 HD0704 tatA, - HD0716 HD0713 tatC, - HD0714 fbp, - HD0702 ubiB, - HD0717 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703 HD0704 tatA, - HD0716 HD0713 tatC, - HD0714 fbp, - HD0702 ubiB, - HD0717 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703 Type: tandem, Name:  - 11 HD0704 HD0713 tatC, - HD0714 fbp, - HD0702 ubiB, - HD0717 tatB, - HD0715 tatA, - HD0716 tatB, - HD0715 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703
* Calculated from Protein Sequence

Gene ID: HD0708

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fabG  envM  

Definition:
3-oxoacyl-(acyl-carrier-protein) reductase/short-chain alcohol dehydrogenase

Gene Start:
561259

Gene Stop:
561915

Gene Length:
657

Molecular Weight*:
22568

pI*:
9.10

Net Charge*:
1.95

EC:
1.1.1.100  

Functional Class:
Energy metabolism; Fermentation  
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Secondary Evidence:
Rawlings,M. and Cronan,J.E. Jr.
The gene encoding Escherichia coli acyl carrier protein lies within a cluster of fatty acid biosynthetic genes
J. Biol. Chem. 267 (9), 5751-5754 (1992)
MEDLINE: 92210530

Ren Q, Sierro N, Witholt B, Kessler B.
FabG, an NADPH-dependent 3-ketoacyl reductase of Pseudomonas aeruginosa, provides precursors for medium-chain-length
poly-3-hydroxyalkanoate biosynthesis in Escherichia coli.
J Bacteriol. 2000 May;182(10):2978-81.
PMID: 10781572


Comment:
For other "fab" genes, see HD1188 (fabZ), HD1266 (fabI), HD0612 (fabB), HD0707 (fabD), HD0774 (fabH).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 3-oxoacyl-(acyl-carrier-protein) reductases; e.g., residues 1-218 are 77% similar to FABG_HAEIN [1169591], residues 2-218 are 74% similar to FABG_ECOLI [2506148], and residues 2-218 are 74% similar to FABG_SALTY [6685440].

COGS Summary:  COGS Search
BeTs to 12 clades of COG1028
COG name: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Functional Class:  R
The phylogenetic pattern of COG1028 is a--KYQVCEBRHUJ----inX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002198 (Short-chain dehydrogenase/reductase (SDR) superfamily) with a combined E-value of 3.8e-18.
    IPB002198    128-163


ProDom Summary:  Protein Domain Search
Residues 57-126 are 72% similar to a (OXIDOREDUCTASE DEHYDROGENASE COMPLETE PROTEOME) protein domain (PD126102) which is seen in Q9CJS6_PASMU.

Residues 173-218 are 76% similar to a (OXIDOREDUCTASE DEHYDROGENASE COMPLETE PROTEOME NAD) protein domain (PD000197) which is seen in Q9CJS6_PASMU.

Residues 128-171 are 93% similar to a (OXIDOREDUCTASE DEHYDROGENASE COMPLETE PROTEOME NAD) protein domain (PD003795) which is seen in Q9CJS6_PASMU.

Residues 4-49 are 93% similar to a (OXIDOREDUCTASE DEHYDROGENASE COMPLETE PROTEOME) protein domain (PD058480) which is seen in Q9CJS6_PASMU.

Residues 7-118 are 30% similar to a (COMPLETE PROTEOME 4-EPIMERASE REDUCTASE UDP-GLUCOSE NAD) protein domain (PD000038) which is seen in O32457_BBBBB.



Paralogs:  Local Blast Search


HD0708 is paralogously related to HD0880 (1e-12) and HD1266 (3e-12).


Pfam Summary:  Pfam Search
Residues 6 to 218 (E-value = 1.8e-68) place HD0708 in the adh_short family which is described as short chain dehydrogenase (PF00106)

PDB Hit:
pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Ca... 319 2e-088
pdb|1EDO|A Chain A, The X-Ray Structure Of Beta-Keto Acyl Carri... 192 3e-050
pdb|1HDC|A Chain A, 3-Alpha, 20-Beta-Hydroxysteroid Dehydrogena... 112 4e-026

Gene Protein Sequence:
MQGKIALVTGATRGIGKAIAEELSAKGAIVIGTATSEKGAETISAYLGET
GKGLVLDVANPASIETVLAEIKAQFGEVDILVNNAGITRDGLLMRMKDQD
WYDIVETNLTSVFRLSKAVLRPMMKKGGRIVTIGSVVGSSGNPGQTNYCA
AKAGLVGFSKALAKEVASRGITVNVVAPGFIATDMTDELSEDQRNAILSQ
IPAGKLGSAKDIAKVVAF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAGGTAAAATCGCATTAGTAACAGGCGCAACACGTGGTATTGGTAA
AGCTATCGCCGAGGAATTAAGTGCAAAAGGCGCGATCGTTATTGGTACAG
CAACATCAGAAAAAGGGGCTGAAACCATCTCAGCTTATTTAGGTGAAACA
GGCAAGGGGCTTGTTTTAGACGTCGCAAATCCTGCATCAATTGAAACGGT
GTTAGCAGAAATTAAAGCACAATTTGGTGAGGTAGATATTTTAGTAAATA
ATGCAGGCATTACCCGCGATGGTTTATTAATGCGTATGAAAGATCAAGAT
TGGTACGATATTGTTGAAACAAACTTGACTTCTGTCTTCCGTTTATCAAA
AGCGGTATTACGCCCAATGATGAAAAAAGGCGGTCGTATTGTGACGATTG
GATCTGTAGTGGGTTCAAGTGGCAATCCTGGTCAAACAAACTATTGTGCA
GCAAAAGCAGGTTTGGTTGGTTTTTCTAAAGCATTGGCAAAAGAAGTGGC
TTCGCGTGGTATTACCGTTAATGTAGTGGCTCCGGGGTTTATTGCGACAG
ATATGACAGATGAGTTAAGTGAAGATCAAAGAAATGCAATTTTAAGCCAA
ATTCCGGCAGGAAAATTAGGATCCGCAAAAGATATTGCGAAAGTAGTTGC
ATTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy