Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR496 IGR501 IGR497 IGR499 IGR502 IGR503 IGR495 IGR498 IGR500 HD0704 HD0713 tatC, - HD0714 fbp, - HD0702 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703 HD0704 HD0713 tatC, - HD0714 fbp, - HD0702 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703 Type: tandem, Name:  - 11 HD0704 HD0713 tatC, - HD0714 fbp, - HD0702 tatB, - HD0715 tatB, - HD0715 fabG,envM, - HD0708 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703
* Calculated from Protein Sequence

Gene ID: HD0707

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fabD  

Definition:
malonyl coA-acyl carrier protein transacylase

Gene Start:
560269

Gene Stop:
561204

Gene Length:
936

Molecular Weight*:
33019

pI*:
4.90

Net Charge*:
-8.21

EC:
2.3.1.39  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Secondary Evidence:
Rawlings,M. and Cronan,J.E. Jr.
The gene encoding Escherichia coli acyl carrier protein lies within a cluster of fatty acid biosynthetic genes
J. Biol. Chem. 267 (9), 5751-5754 (1992)
MEDLINE: 92210530

Serre,L., Verbree,E.C., Dauter,Z., Stuitje,A.R. and Derewenda,Z.S.
The Escherichia coli malonyl-CoA:acyl carrier protein transacylase
at 1.5-A resolution. Crystal structure of a fatty acid synthase
component
J. Biol. Chem. 270 (22), 12961-12964 (1995)
MEDLINE: 95286570




Comment:
For other "fab" genes, see HD1188 (fabZ), HD1266 (fabI), HD0612 (fabB), HD0708 (fabG), HD0774 (fabH).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to malonyl coA-acyl carrier protein transacylases; e.g., residues 1-310 are 71% similar to FABD_HAEIN [1169590], residues 1-310 are 69% similar to the sequence for malonyl Coa-acyl carrier protein transacylase in Vibrio cholerae [9656566], and residues 1-308 are 63% similar to FABD_ECOLI [119785].

COGS Summary:  COGS Search
BeTs to 10 clades of COG0331
COG name: (acyl-carrier-protein) S-malonyltransferase
Functional Class:  I
The phylogenetic pattern of COG0331 is ----YqvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001227 (Acyl transferase domain) with a combined E-value of 1.4e-06.
    IPB001227A    86-98
    IPB001227B    282-289
***** PR01483 (Fatty acid synthase signature) with a combined E-value of 8.3e-06.
    PR01483K    81-100


ProDom Summary:  Protein Domain Search
Residues 7-183 are 77% similar to a (PHOSPHOPANTETHEINE TRANSFERASE SYNTHASE) protein domain (PD000287) which is seen in FABD_HAEIN.

Residues 193-291 are 60% similar to a (PHOSPHOPANTETHEINE TRANSFERASE SYNTHASE) protein domain (PD338968) which is seen in FABD_ECOLI.



Paralogs:  Local Blast Search

HD0707 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 311 (E-value = 1.9e-12) place HD0707 in the Acyl_transf_1 family which is described as Acyl transferase domain (PF00698)

PDB Hit:
pdb|1MLA| Mol_id: 1; Molecule: Malonyl-Coenzyme A Acyl Carrie... 393 1e-110

Gene Protein Sequence:
MSNFAMVFPGQGSQAVGMLAELATEFPIVEQVFAEASEVLGYDLWALVQH
GTAEELSQTQRTQPALLAASVAIYRVWQQKYPELKPAMMAGHSLGEYSAL
VCAGVLNFQDAIKLVELRGNAMQQAVPAGSGAMYAIIGLENNLIINACQQ
AQLELGEVVSAVNFNSPGQVAIAGSKTAVEKAAELCKTAGAKRALPLAVS
VPSHCSLMKPAAEELAAALQNISLNPPRIPVIHNVNVAVETDVDAIRERL
VEQLYSPVRWSETIEKMAEQGIDTLFEMGPNKVLTGLAGRIAKQLTAKAI
NDIASLAAVQA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAATTTTGCAATGGTATTCCCAGGTCAAGGTTCACAAGCGGTTGG
TATGTTAGCAGAACTTGCAACGGAATTTCCTATTGTTGAACAAGTATTTG
CCGAAGCCAGTGAGGTTTTGGGCTATGATTTATGGGCGCTTGTTCAGCAT
GGTACAGCAGAAGAATTAAGTCAAACACAACGCACACAACCTGCATTATT
AGCCGCATCAGTTGCAATTTATCGTGTTTGGCAACAAAAATACCCTGAGT
TGAAACCCGCTATGATGGCTGGACATAGTTTAGGCGAGTATTCAGCTTTG
GTGTGTGCTGGCGTATTGAATTTCCAAGATGCCATCAAATTAGTTGAATT
ACGTGGTAATGCTATGCAACAGGCAGTGCCTGCAGGTAGCGGCGCTATGT
ATGCGATTATTGGTTTAGAGAATAATTTGATTATTAATGCTTGCCAACAA
GCACAGCTTGAATTGGGCGAAGTGGTTTCAGCGGTTAATTTTAATAGTCC
AGGTCAAGTGGCTATTGCTGGGAGTAAAACTGCGGTAGAAAAAGCGGCGG
AATTATGTAAAACAGCGGGTGCGAAACGGGCATTACCATTAGCAGTAAGT
GTGCCTTCACATTGCTCACTCATGAAGCCTGCTGCAGAAGAGCTAGCCGC
TGCATTGCAAAATATTTCATTAAATCCACCGCGTATACCTGTTATTCATA
ATGTGAATGTCGCTGTTGAAACAGATGTAGATGCTATTCGCGAGCGGTTG
GTTGAACAGCTTTATAGTCCCGTTCGTTGGAGCGAAACTATTGAAAAAAT
GGCTGAACAAGGTATAGATACCCTCTTTGAAATGGGGCCGAATAAAGTAT
TAACCGGTTTAGCTGGACGGATTGCTAAACAATTAACGGCAAAAGCAATC
AATGATATTGCCTCATTAGCGGCTGTACAGGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy