Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR496 IGR501 IGR497 IGR499 IGR494 IGR495 IGR493 IGR498 IGR500 HD0704 oxyR, - HD0699 fbp, - HD0702 fabG,envM, - HD0708 grx, - HD0700 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703 HD0704 oxyR, - HD0699 fbp, - HD0702 fabG,envM, - HD0708 grx, - HD0700 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703 Type: tandem, Name:  - 11 HD0704 oxyR, - HD0699 fbp, - HD0702 fabG,envM, - HD0708 grx, - HD0700 HD0706 fpg,mutM, - HD0710 fabD, - HD0707 ispB, - HD0705 braB,brnQ, - HD0709 mpl, - HD0703
* Calculated from Protein Sequence

Gene ID: HD0705

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ispB  

Definition:
octaprenyl-diphosphate synthase

Gene Start:
558354

Gene Stop:
559349

Gene Length:
996

Molecular Weight*:
36260

pI*:
5.70

Net Charge*:
-7.01

EC:
2.5.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Biosynthesis and degradation of glycoprotein
Porphyrin and chlorophyll metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Pan JJ, Kuo TH, Chen YK, Yang LW, Liang PH.
Insight into the activation mechanism of Escherichia coli octaprenyl pyrophosphate synthase derived from pre-steady-state kinetic analysis.
Biochim Biophys Acta. 2002 Jan 31;1594(1):64-73.
PMID: 11825609

Kainou T, Okada K, Suzuki K, Nakagawa T, Matsuda H, Kawamukai M.
Dimer formation of octaprenyl-diphosphate synthase (IspB) is essential for chain length determination of ubiquinone.
J Biol Chem. 2001 Mar 16;276(11):7876-83.
PMID: 11108713

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to octaprenyl-diphosphate synthase proteins; e.g., residues 9-331 are 69% similar to ISPB_HAEIN [1170590], residues 1-329 are 63% similar to the sequence for octaprenyl-diphosphate synthase in Vibrio cholerae [9654858], and residues 9-329 are 65% similar to ISPB_ECOLI [465645].

COGS Summary:  COGS Search
BeTs to 16 clades of COG0142
COG name: Geranylgeranyl pyrophosphate synthase
Functional Class: H
The phylogenetic pattern of COG0142 is AmtkYQVCEBRHUJ--olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000092 (Polyprenyl synthetase) with a combined E-value of 5.7e-27.
    IPB000092A    51-60
    IPB000092B    81-92
    IPB000092C    93-108
    IPB000092D    153-158
    IPB000092E    211-233


ProDom Summary:  Protein Domain Search
Residues 17-192 are 75% similar to a (SYNTHASE SYNTHETASE PYROPHOSPHATE TRANSFERASE) protein domain (PD000572) which is seen in Q9CNS9_PASMU.

Residues 193-252 are 71% similar to a (SYNTHASE SYNTHETASE TRANSFERASE DIPHOSPHATE) protein domain (PD003059) which is seen in Q9CNS9_PASMU.

Residues 259-329 are 73% similar to a (SYNTHASE SYNTHETASE) protein domain (PD023946) which is seen in ISPB_HAEIN.



Paralogs:  Local Blast Search
HD0705 is paralogously related to HD1322 (4e-22).


Pfam Summary:  Pfam Search
Residues 39 to 293 (E-value = 6.2e-110) place HD0705 in the polyprenyl_synt family which is described as Polyprenyl synthetase (PF00348)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LRNIMTAQLTLEQIQALAQQDMQAVDQEILAQLNSEVPLINQLGHYIISG
GGKRIRPLIAVLAANALCYTGRKHLTCAAFIEFVHTATLLHDDVVDESAL
RRGRETANAIFGNAASVLVGDFIYTRSFQMMTSVDSLEVLKVMSAATNAL
AEGEVQQLMNINDPHTTEANYMRVIYNKTARLFEAATQCVAIVAGASQQI
EQALKAYGCYLGTAFQLVDDILDYSAKAEQFGKNVGDDFVEGKPTLPLLH
ALQHANEAQASMIREAIEHGGERAKIPMVLAIMAEHKSLEYAMARAKQEA
QKAVAALDILADTEYKKALISLAYLSVDRRY$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGAAATATCATGACAGCGCAATTAACACTTGAACAGATCCAAGCTCT
TGCACAGCAAGATATGCAAGCCGTTGATCAAGAGATTCTTGCTCAGCTGA
ATTCTGAAGTGCCACTCATTAATCAATTAGGCCATTACATTATCAGTGGC
GGTGGCAAACGTATTCGTCCATTGATTGCCGTATTAGCAGCCAATGCCTT
ATGTTACACAGGGCGTAAGCATTTGACTTGTGCCGCCTTTATTGAATTTG
TACATACTGCCACTTTATTACACGATGATGTTGTTGATGAATCGGCTTTA
CGGCGTGGACGTGAAACGGCGAATGCAATTTTTGGAAATGCGGCAAGTGT
TTTAGTTGGCGATTTTATTTATACACGCTCATTTCAAATGATGACGTCGG
TTGATTCACTGGAAGTATTAAAAGTGATGTCAGCAGCCACCAATGCATTA
GCTGAAGGTGAAGTGCAACAATTAATGAATATTAATGACCCGCATACTAC
CGAAGCAAATTATATGCGAGTCATTTATAACAAAACTGCCCGCTTATTTG
AAGCTGCTACACAATGTGTAGCGATAGTTGCTGGTGCTAGCCAACAGATT
GAACAGGCTTTAAAAGCCTATGGTTGCTATTTAGGCACAGCTTTTCAATT
AGTGGATGATATTTTAGATTATTCAGCAAAAGCAGAACAATTTGGGAAAA
ATGTAGGCGATGACTTTGTAGAAGGTAAACCAACTTTGCCATTATTGCAT
GCTTTGCAACACGCAAATGAAGCACAAGCAAGTATGATTCGCGAAGCGAT
TGAGCATGGTGGCGAACGTGCAAAAATTCCGATGGTGTTGGCGATTATGG
CTGAGCATAAATCATTGGAATATGCAATGGCACGTGCTAAGCAAGAAGCA
CAAAAAGCGGTAGCAGCATTGGATATTTTAGCAGATACCGAATATAAAAA
AGCGTTGATTTCATTGGCATACTTGTCGGTGGATCGGCGTTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy