Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR492 IGR496 IGR497 IGR491 IGR494 IGR495 IGR493 IGR498 HD0704 HD0697 oxyR, - HD0699 fbp, - HD0702 vacB,rnr, - HD0695 grx, - HD0700 HD0706 fabD, - HD0707 ispB, - HD0705 mpl, - HD0703 HD0704 HD0697 oxyR, - HD0699 fbp, - HD0702 vacB,rnr, - HD0695 grx, - HD0700 HD0706 fabD, - HD0707 ispB, - HD0705 mpl, - HD0703 HD0704 oxyR, - HD0699 fbp, - HD0702 vacB,rnr, - HD0695 HD0698 HD0697 HD0698 grx, - HD0700 HD0706 fabD, - HD0707 ispB, - HD0705 mpl, - HD0703
* Calculated from Protein Sequence

Gene ID: HD0702

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fbp  

Definition:
fructose-1,6-bisphosphatase

Gene Start:
556642

Gene Stop:
555638

Gene Length:
1005

Molecular Weight*:
37153

pI*:
5.40

Net Charge*:
-5.06

EC:
3.1.3.11  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Secondary Evidence:
Hamilton,W.D., Harrison,D.A. and Dyer,T.A.
Sequence of the Escherichia coli fructose-1,6-bisphosphatase gene
Nucleic Acids Res. 16 (17), 8707 (1988)
MEDLINE: 88335617

Marcus,F., Gontero,B., Harrsch,P.B. and Rittenhouse,J.
Amino acid sequence homology among fructose-1,6-bisphosphatases
Biochem. Biophys. Res. Commun. 135 (2), 374-381 (1986)
MEDLINE: 86186761

Tang GL, Yang CS, Bao JS, Wang YF, Chen HB, Shi DJ, Liu FL.
Co-expression of Triosephosphate Isomerase, Fructose-1, 6-bisphosphate Aldolase and Fructose-1, 6-bisphosphatase in E.coli.
Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai). 2001;33(1):131-136.
PMID: 12053203


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to fructose-1,6-bisphosphatase proteins; e.g., residues 1-334 are 76% similar to F16P_HAEIN [1169583], residues 1-334 are 69% similar to the sequence for fructose-1,6-bisphosphatase in Vibrio cholerae [9657128], residues 1-334 are 65% similar to F16P_ECOLI [119724], and residues 1-318 are 47% similar to F16Q_ORYSA [3913640].

COGS Summary:  COGS Search
BeTs to 4 clades of COG0158
COG name: Fructose-1,6-biphosphatase
Functional Class:  G
The phylogenetic pattern of COG0158 is ----y--ce--huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000146 (Inositol phosphatase/fructose-1,6-bisphosphatase) with a combined E-value of 1.7e-77.
    IPB000146A    51-93
    IPB000146B    106-133
    IPB000146C    151-185
    IPB000146D    271-291


ProDom Summary:  Protein Domain Search
Residues 60-322 are 77% similar to a (HYDROLASE CARBOHYDRATE METABOLISM) protein domain (PD001491) which is seen in Q9CMA4_PASMU.

Residues 3-59 are 73% similar to a (HYDROLASE METABOLISM) protein domain (PD359889) which is seen in Q9CMA4_PASMU.



Paralogs:  Local Blast Search
HD0702 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 332 (E-value = 3.3e-189) place HD0702 in the FBPase family which is described as Fructose-1-6-bisphosphatase (PF00316)

PDB Hit:
pdb|1BK4|A Chain A, Crystal Structure Of Rabbit Liver Fructose-... 255 5e-069
pdb|1SPI|A Chain A, Fructose-1,6-Bisphosphatase (D-Fructose-1,6... 253 3e-068
pdb|1EYI|A Chain A, Fructose-1,6-Bisphosphatase Complex With Ma... 250 1e-067

Gene Protein Sequence:
MKTLGEFIIEKQAEYPEAKGELSGILASIRLAAKIIHREINRAGLSQDIL
GFAGSENVQGETQMKLDIFANETMKKALLAREDVAGFASEEDDNFIAFDS
ERNRNAKYILMTDPLDGSSNIDVNVSVGTIFSIYKRISPIGSPVTIEDFL
QEGRKQVAAGYVTYGSSTMLVYTTGNGVNGFTYDPSLGLFILSHPDMKMP
AEGKYYSINEGQYVTFPLGVKKFIKYCQENDEASKRPYSSRYIGSLVSDF
HRNLLKGGIYIYPTSTVYPQGKLRLLYEGNPMAFLAEQADGMATDGFQPI
LDIKPTELHQRVPFFIGSKTMVKQANTFMQTFTE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACGCTTGGCGAATTTATCATTGAAAAACAAGCCGAATATCCTGA
AGCAAAAGGAGAATTAAGTGGCATTTTGGCCTCTATCCGTTTAGCCGCCA
AAATCATTCACCGCGAAATTAATCGTGCTGGACTAAGCCAAGATATTCTT
GGTTTTGCCGGCTCAGAGAATGTACAAGGTGAAACACAAATGAAGCTAGA
TATTTTTGCCAATGAAACCATGAAAAAAGCCTTACTTGCTCGTGAAGATG
TAGCAGGCTTTGCTTCAGAAGAAGATGATAATTTTATTGCTTTTGATAGC
GAACGAAATAGAAATGCCAAATATATCTTAATGACAGATCCGCTAGATGG
CTCTTCCAACATTGATGTAAATGTTTCGGTCGGCACTATTTTTTCTATTT
ATAAACGTATCTCGCCGATCGGCTCTCCCGTAACAATTGAAGATTTTTTA
CAAGAAGGGCGTAAACAAGTTGCAGCGGGTTATGTGACTTATGGTTCATC
AACAATGTTGGTTTACACGACAGGCAATGGCGTAAACGGCTTTACTTACG
ATCCATCGCTTGGCTTATTTATTCTTTCTCATCCAGATATGAAAATGCCG
GCTGAAGGTAAATATTATTCGATCAATGAAGGGCAATACGTCACCTTCCC
TCTGGGGGTGAAAAAATTTATCAAATATTGCCAAGAAAATGATGAAGCAA
GCAAACGGCCTTATTCATCTCGTTATATCGGCTCACTAGTTTCTGATTTT
CACCGTAATTTACTCAAAGGCGGTATTTATATTTACCCAACCTCAACGGT
TTATCCACAAGGCAAATTACGGCTACTGTATGAAGGCAATCCAATGGCAT
TTTTAGCTGAACAAGCTGATGGTATGGCAACCGATGGTTTCCAACCGATT
TTAGATATCAAACCAACCGAATTACACCAACGTGTACCGTTCTTTATTGG
TTCTAAGACAATGGTCAAACAAGCTAACACCTTTATGCAAACTTTCACTG
AATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy