Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR492 IGR491 IGR488 IGR489 IGR486 IGR487 IGR490 HD0697 oxyR, - HD0699 tyrS, - HD0693 vacB,rnr, - HD0695 rpS21,rpsU,rs21, - HD0689 dnaG, - HD0690 rpoD, - HD0691 HD0697 oxyR, - HD0699 tyrS, - HD0693 vacB,rnr, - HD0695 rpS21,rpsU,rs21, - HD0689 dnaG, - HD0690 rpoD, - HD0691 oxyR, - HD0699 tyrS, - HD0693 vacB,rnr, - HD0695 HD0694 HD0698 HD0694 HD0697 HD0698 rpS21,rpsU,rs21, - HD0689 dnaG, - HD0690 rpoD, - HD0691
* Calculated from Protein Sequence

Gene ID: HD0693

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tyrS  

Definition:
tyrosyl-tRNA synthetase, tyrS

Gene Start:
549896

Gene Stop:
548682

Gene Length:
1215

Molecular Weight*:
45243

pI*:
6.80

Net Charge*:
-0.57

EC:
6.1.1.1  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Yaremchuk A, Kriklivyi I, Tukalo M, Cusack S.
Class I tyrosyl-tRNA synthetase has a class II mode of cognate tRNA recognition.
EMBO J. 2002 Jul 15;21(14):3829-40.
PMID: 12110594

Comment:


Blast Summary:  PSI-Blast Search
Many very strong hits in gapped BLAST to tyrosyl-tRNA synthetase proteins; e.g., residues 13-401 are 84% similar to SYY_HAEIN [1174554], residues 12-404 are 76% similar to the sequence for tyrosyl-tRNA synthetase in Vibrio cholerae [9655066], and resdieus 14-401 are 55% similar to SYY_AQUAE [6226204].

COGS Summary:  COGS Search
BeTs to 16 clades of COG0162
COG name: Tyrosyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0162 is amtkYqvCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 7.1e-06.
    IPB001412A    50-60
    IPB001412B    232-242


ProDom Summary:  Protein Domain Search
Residues 330-401 are 80% similar to a (SYNTHETASE LIGASE TYROSYL-TRNA) protein domain (PD004483) which is seen in SYY_HAEIN.

Residues 260-329 are 74% similar to a (SYNTHETASE TYROSYL-TRNA LIGASE) protein domain (PD040475) which is seen in Q9KU92_VIBCH.

Residues 175-317 are 30% similar to a (SYNTHETASE LIGASE TYROSYL-TRNA) protein domain (PD131906) which is seen in Q9CIH5_LACLA.

Residues 13-176 are 87% similar to a (SYNTHETASE LIGASE TYROSYL-TRNA) protein domain (PD005447) which is seen in Q9CMQ8_PASMU.

Residues 178-259 are 92% similar to a (SYNTHETASE LIGASE TYROSYL-TRNA) protein domain (PD379913) which is seen in SYY_HAEIN.

Residues 177-259 are 91% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD001451) which is seen in Q9CMQ8_PASMU.



Paralogs:  Local Blast Search
HD0693 is paralogously related to HD0177 (6e-04).


Pfam Summary:  Pfam Search
Residues 38 to 326 (E-value = 4.9e-118) place HD0693 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)
Residues 343 to 390 (E-value = 4.1e-05) place HD0693 in the S4 family which is described as S4 domain (PF01479)

PDB Hit:
pdb|2TS1| Tyrosyl-Transfer RNA Synthetase (E.C.6.1.1.1) >gi|2... 141 1e-034
pdb|1TYA|E Chain E, Tyrosyl-Transfer Rna Synthetase (E.C.6.1.1.... 126 4e-030
pdb|4TS1|A Chain A, Des-(Ile 318-Arg 417)-Tyrosyl-Transfer RNA ... 126 4e-030

Gene Protein Sequence:
MLIRKGIQMAQSIEAILAELKRGVENIYSEEDLIAKLKENRPLRIKLGAD
PTAPDIHLGHTVVINKLRQFQQLGHEVIFLIGDFTGMVGDPSGKNTTRPP
LTREDVLRNAETYKQQLFKILDPNKTRVVFNSAWLNELGTEGMIRLTSNY
TVARMLERDDFKKRFTNNQPIAIHEFIYPLLQGYDSVALQADVELGGTDQ
TFNLLVGRELQKSAEQKPQVAITLPLLVGLDGEKKMSKSLGNYIGVTEAP
NEMFGKVMSISDELMWDWYNLLSFRPLAEITQLKADVDAGKNPRDVKILL
AKEIITRFHSEAEADLAEQHFINRFQKGAIPDEMPEFCFNGEIGLATLLK
EAGLVASTSEAIRSAQQGGVKIDGQKIDDVRANAQLGTFVYQVGKRKFAR
VTVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAATCAGAAAAGGAATACAAATGGCTCAATCTATTGAAGCAATATT
AGCCGAACTTAAGCGTGGTGTCGAAAATATTTATTCTGAAGAAGATTTAA
TTGCAAAACTAAAAGAAAATCGTCCATTACGGATTAAATTAGGTGCCGAT
CCAACAGCACCCGATATTCACTTAGGCCATACTGTTGTTATCAACAAGCT
ACGTCAATTCCAACAATTAGGCCACGAAGTTATCTTCTTAATTGGTGACT
TTACCGGTATGGTGGGCGATCCATCAGGCAAAAACACCACTCGCCCGCCA
TTAACACGTGAAGATGTACTGCGTAACGCCGAAACTTACAAACAACAATT
ATTTAAAATCTTAGATCCCAACAAAACACGTGTCGTATTTAATTCTGCGT
GGTTAAATGAATTAGGCACAGAAGGAATGATTCGCTTAACGTCTAATTAT
ACCGTGGCACGTATGCTAGAACGTGATGATTTCAAAAAACGTTTCACTAA
TAATCAACCTATCGCTATTCACGAATTTATCTATCCATTATTACAAGGTT
ATGATTCCGTCGCATTGCAAGCCGACGTAGAATTAGGTGGCACAGACCAA
ACTTTTAATCTATTGGTTGGTCGTGAATTACAAAAATCAGCGGAACAGAA
GCCTCAAGTCGCCATCACCTTACCATTATTAGTCGGCTTAGATGGCGAGA
AAAAAATGTCTAAATCATTAGGCAATTATATTGGTGTTACCGAAGCACCT
AATGAAATGTTTGGCAAAGTAATGTCCATTTCTGATGAGCTGATGTGGGA
TTGGTATAATTTACTTTCTTTCCGACCATTAGCTGAAATTACTCAATTAA
AAGCAGACGTTGACGCTGGAAAAAATCCTCGTGACGTGAAAATTTTATTA
GCTAAAGAAATTATTACCCGCTTCCATAGTGAAGCTGAGGCTGACCTTGC
TGAACAACACTTTATTAACCGCTTCCAAAAAGGCGCTATTCCTGATGAAA
TGCCAGAATTCTGTTTCAACGGCGAAATTGGGCTTGCCACTTTATTAAAA
GAAGCGGGCTTAGTTGCCTCAACGTCTGAAGCGATCCGCTCTGCACAACA
AGGTGGAGTTAAAATCGATGGACAAAAAATTGATGATGTCCGCGCCAATG
CTCAACTAGGGACATTCGTCTATCAGGTAGGCAAACGTAAATTTGCTCGT
GTTACCGTAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy