Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR485 IGR483 IGR484 IGR488 IGR489 IGR486 IGR487 IGR490 tyrS, - HD0693 vacB,rnr, - HD0695 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 lst, - HD0686 rmlA, - HD0688 rmlB, - HD0687 dnaG, - HD0690 rpoD, - HD0691 tyrS, - HD0693 vacB,rnr, - HD0695 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 lst, - HD0686 rmlA, - HD0688 rmlB, - HD0687 dnaG, - HD0690 rpoD, - HD0691 tyrS, - HD0693 vacB,rnr, - HD0695 HD0694 HD0694 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 lst, - HD0686 rmlA, - HD0688 rmlB, - HD0687 dnaG, - HD0690 rpoD, - HD0691
* Calculated from Protein Sequence

Gene ID: HD0690

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dnaG  

Definition:
DNA primase

Gene Start:
544815

Gene Stop:
546554

Gene Length:
1740

Molecular Weight*:
65152

pI*:
6.60

Net Charge*:
-2.72

EC:
2.7.7.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Porphyrin and chlorophyll metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Erickson,B.D., Burton,Z.F., Watanabe,K.K. and Burgess,R.R. 1985 Nucleotide sequence of the rpsU-dnaG-rpoD operon from Salmonella
typhimurium and a comparison of this sequence with the homologous
operon of Escherichia coli.
Gene 40(1):67-78
Medline: 86137422.

Burton,Z.F., Gross,C.A., Watanabe,K.K. and Burgess,R.R. 1983.
The operon that encodes the sigma subunit of RNA polymerase also
encodes ribosomal protein S21 and DNA primase in E. coli K12.
Cell 32(2):335-349
Medline: 83129424

Smiley,B.L., Lupski,J.R., Svec,P.S., McMacken,R. and Godson,G.N. 1982.
Sequences of the Escherichia coli dnaG primase gene and regulation of its expression.
Proc. Natl. Acad. Sci. U.S.A. 79(15):4550-4554.
Medline: 83014926

Versalovic,J. and Lupski,J.R. 1993.
The Haemophilus influenzae dnaG sequence and conserved bacterial primase motifs.
Gene 136(1-2):281-286.
Medline: 94124015

Comment:
For other "dna" genes, see HD1372 (dnaB), HD1771 (dnaJ), HD1819 (dnaX), HD0189 (dnaK), HD1935 (dnaX), HD0551 (dnaE), HD0973 (dnaB), HD0850 (dnaN), HD0851 (dnaA)

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to DNA primase proteins; e.g., residues 1-578 are 63% similar to PRIM_HAEIN [1172619], residues 1-573 are 56% similar to PRIM_ECOLI [130908], and residues 1-573 are 55% similar to PRIM_SALTY [130909].

COGS Summary:  COGS Search
BeTs to 16 clades of COG0358
COG name: DNA primase (bacterial type)
Functional Class: L
The phylogenetic pattern of COG0358 is amtk-qvcebrhujGPolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002694 (CHC2 zinc finger) with a combined E-value of 9.9e-129.
    IPB002694A    40-85
    IPB002694B    142-162
    IPB002694C    197-221
    IPB002694D    228-247
    IPB002694E    262-299
    IPB002694F    301-314
    IPB002694G    340-350


ProDom Summary:  Protein Domain Search
Residues 211-358 are 85% similar to a (DNA PRIMASE 2.7.7.- TRANSFERASE) protein domain (PD002276) which is seen in Q9CLI9_PASMU.

Residues 366-577 are 58% similar to a (DNA PRIMASE REPLICATION METAL-BINDING) protein domain (PD011358) which is seen in Q9CLI9_PASMU.

Residues 94-199 are 57% similar to a (DNA PRIMASE REPLICATION METAL-BINDING) protein domain (PD003861) which is seen in Q9CLI9_PASMU.

Residues 115-210 are 30% similar to a (DNA TRANSFERASE POLYMERASE PRIMASE) protein domain (PD290405) which is seen in PRIM_BUCAI.

Residues 36-92 are 85% similar to a (DNA PRIMASE 2.7.7.- TRANSFERASE) protein domain (PD002988) which is seen in Q9CLI9_PASMU.

Residues 112-208 are 36% similar to a (DNA TRANSFERASE POLYMERASE PRIMASE) protein domain (PD414937) which is seen in PRIM_HELPJ.



Paralogs:  Local Blast Search
HD0690 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 102 (E-value = 6.4e-64) place HD0690 in the zf-CHC2 family which is described as CHC2 zinc finger (PF01807)
Residues 259 to 341 (E-value = 1.4e-24) place HD0690 in the Toprim family which is described as Toprim domain (PF01751)

PDB Hit:
pdb|1DD9|A Chain A, Structure Of The Dnag Catalytic Core >gi|77... 413 4e-116
pdb|1EQN|A Chain A, E.Coli Primase Catalytic Core >gi|9256899|p... 393 2e-110
pdb|1D0Q|A Chain A, Structure Of The Zinc-Binding Domain Of Bac... 101 3e-022

Gene Protein Sequence:
MKGSIPRSFIDDLVARTDIVELINSRVKLKKAGREYQSCCPFHHEKSPSF
TVSPTKQFYYCFGCGAHGNAISFLMEYDKLEFPEAVEELAAMQGLEVPRE
NATHQAKSVVSYQAKRNLYELLAQISQFYQQHLVQDSASQAYLQQRGLSA
EIISRFEIGFAPNSMDAVLCKFGINRDEIQKLLDTGMLSQHDSGRVYDKF
RNRVMFPIRDKRGRVVAFGGRVMGDEKPKYLNSPESATYHKGNELYGLFQ
ALQQNENPAALLVVEGYMDVVALAQFGVNNAVASLGTATTGEQIQQMFRC
TEQVICCYDGDRAGREAAWRAFENALPYLQDGRQLKFIFLPDGEDPDSFI
RQQGKAGFEAYLQAGMSLSDFLFDNLIAQVDLSSKEGKSKLAALAVPLIN
RIPGEMLRVYLRNMLGQKLGILDPAQLEAILPAKVPANRKSIAQALPIKR
TPMRLLIALLLQNPELVQFVPDISALQSLQEPGFQLLVELIEVCREKVGI
SMGVLLEHWRDKPHYRTLERLANWDHLVTPENVESTFIETLDFLYAKLVE
KRIEALIAKDRMHGLNAAEKQELALLISQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGGTAGCATACCTCGTTCATTTATTGATGATCTTGTCGCTCGCAC
AGATATCGTTGAACTGATCAATAGTCGCGTTAAACTCAAAAAAGCAGGCA
GAGAGTATCAAAGCTGTTGTCCTTTTCATCATGAAAAAAGCCCATCATTT
ACGGTAAGCCCGACTAAACAGTTTTACTATTGTTTTGGCTGTGGTGCACA
CGGTAATGCGATCAGTTTTTTGATGGAATATGACAAGTTAGAATTTCCGG
AAGCGGTTGAAGAATTAGCTGCAATGCAAGGCTTAGAAGTCCCACGTGAA
AATGCCACTCATCAAGCTAAATCAGTGGTGAGTTATCAAGCGAAGCGGAA
TCTATATGAATTATTGGCGCAAATTAGCCAATTTTACCAACAACATTTAG
TGCAAGACTCTGCTAGTCAAGCTTATTTGCAACAGCGAGGGCTTTCTGCT
GAGATTATTAGCCGTTTTGAGATTGGATTTGCCCCTAATTCAATGGATGC
CGTCCTATGTAAATTTGGTATTAATCGTGACGAGATACAGAAATTGCTTG
ATACGGGAATGCTCAGCCAACATGATAGTGGACGAGTTTACGATAAATTC
CGTAATCGAGTAATGTTCCCAATTCGCGATAAGCGTGGGCGCGTGGTTGC
TTTTGGCGGACGAGTGATGGGCGATGAAAAACCTAAATACCTTAATTCTC
CTGAGTCAGCAACCTATCACAAAGGCAATGAGCTTTACGGTCTGTTTCAA
GCATTGCAACAAAATGAGAATCCGGCGGCGTTGCTAGTAGTCGAAGGCTA
TATGGATGTTGTAGCGCTTGCACAATTTGGTGTGAACAATGCGGTAGCGT
CTTTAGGGACAGCCACTACGGGTGAGCAAATTCAGCAGATGTTTCGTTGT
ACTGAGCAAGTTATTTGTTGCTATGACGGAGATCGTGCCGGTCGAGAAGC
CGCTTGGCGAGCGTTTGAAAATGCTTTGCCTTATTTACAAGATGGCCGTC
AATTAAAATTTATTTTTCTACCGGATGGTGAAGATCCAGATAGTTTTATT
CGGCAACAAGGTAAAGCCGGCTTTGAAGCGTATTTGCAAGCGGGAATGTC
GCTCAGCGATTTTTTATTCGATAATTTGATCGCACAAGTGGATTTATCAA
GTAAAGAGGGCAAATCCAAGTTGGCGGCGCTTGCAGTACCGTTAATCAAT
CGCATTCCAGGCGAAATGTTACGCGTTTATTTACGTAATATGTTAGGTCA
AAAACTAGGCATTTTAGATCCTGCACAATTAGAAGCTATTTTGCCTGCTA
AAGTACCCGCAAACCGTAAATCAATCGCACAAGCGTTGCCGATTAAGCGG
ACACCCATGCGATTATTGATAGCATTATTGTTGCAGAACCCAGAATTAGT
CCAGTTTGTACCCGATATTTCAGCGCTACAGAGCTTACAAGAACCCGGTT
TCCAATTGCTAGTGGAATTGATCGAAGTGTGCCGCGAAAAAGTCGGTATT
TCAATGGGAGTGTTATTAGAACATTGGCGAGATAAGCCACATTACCGTAC
ATTAGAACGGTTGGCTAATTGGGATCACCTAGTGACGCCTGAAAATGTGG
AAAGTACTTTTATTGAAACGCTTGATTTTTTGTACGCTAAACTAGTTGAA
AAGCGGATAGAAGCACTGATTGCCAAAGATCGTATGCATGGATTAAATGC
TGCAGAAAAACAAGAACTTGCCTTATTAATTAGCCAGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy