Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR485 IGR479 IGR483 IGR478 IGR484 IGR481 IGR480 IGR488 IGR486 IGR487 IGR482 yadR, - HD0684 HD0680 HD0682 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 rmlA, - HD0688 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 dnaG, - HD0690 rpoD, - HD0691 gcr, - HD0678 yadR, - HD0684 HD0680 HD0682 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 rmlA, - HD0688 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 dnaG, - HD0690 rpoD, - HD0691 gcr, - HD0678 yadR, - HD0684 HD0680 HD0682 HD0681 HD0681 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 rmlA, - HD0688 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 dnaG, - HD0690 rpoD, - HD0691 gcr, - HD0678
* Calculated from Protein Sequence

Gene ID: HD0686

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lst  

Definition:
lipooligosaccharide sialyltransferase

Gene Start:
541331

Gene Stop:
542218

Gene Length:
888

Molecular Weight*:
34634

pI*:
9.40

Net Charge*:
7.03

EC:
2.4.99.-  2.7.7.43  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Aminosugars metabolism

Primary Evidence:
Tullius,M.V., Munson,R.S. Jr., Wang,J. and Gibson,B.W. Purification, cloning, and expression of a cytidine
5"-monophosphate N-acetylneuraminic acid synthetase from Haemophilus ducreyi.
J. Biol. Chem. 271 (26), 15373-15380 (1996).


Bozue,J.A., Tullius,M.V., Wang,J., Gibson,B.W. and Munson,R.S. Jr. Haemophilus ducreyi produces a novel sialyltransferase. Identification of the sialyltransferase gene and construction of
mutants deficient in the production of the sialic acid-containing
glycoform of the lipooligosaccharide.
J. Biol. Chem. 274 (7), 4106-4114 (1999).

Secondary Evidence:
Inzana TJ, Glindemann G, Cox AD, Wakarchuk W, Howard MD.
Incorporation of N-acetylneuraminic acid into Haemophilus somnus lipooligosaccharide (LOS): enhancement of resistance to serum
and reduction of LOS antibody binding.
Infect Immun. 2002 Sep;70(9):4870-9.
PMID: 12183531

Chaffin DO, McKinnon K, Rubens CE.
CpsK of Streptococcus agalactiae exhibits alpha2,3-sialyltransferase activity in Haemophilus ducreyi.
Mol Microbiol. 2002 Jul;45(1):109-22.
PMID: 12100552

Shell DM, Chiles L, Judd RC, Seal S, Rest RF.
The Neisseria lipooligosaccharide-specific alpha-2,3-sialyltransferase is a surface-exposed outer membrane protein.
Infect Immun. 2002 Jul;70(7):3744-51.
PMID: 12065517

Jones PA, Samuels NM, Phillips NJ, Munson RS Jr, Bozue JA, Arseneau JA, Nichols WA, Zaleski A, Gibson BW, Apicella MA.
Haemophilus influenzae type b strain A2 has multiple sialyltransferases involved in lipooligosaccharide sialylation.
J Biol Chem. 2002 Apr 26;277(17):14598-611.
PMID: 11842084

Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported lst sequence (4741794) in GenBank.

One significant hit in gapped BLAST to a hypothetical protein in H. influenzae; residues 6-299 are 45% similar to Y871_HAEIN, hypothetical protein HI0871 [1175319].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-294 are identical to a (HI0871 GLYCOSYLTRANSFERASE) protein domain (PD129761) which is seen in Q9X4A1_HAEDU.



Paralogs:  Local Blast Search
HD0686 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 288 (E-value = 2.7e-174) place HD0686 in the LST family which is described as Lipooligosaccharide sialyltransferase (LST) (PF05855)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKEIAIISNQRMFFLYCLLTNKNVEDVFFIFEKGAMPNNLTSISHFIVLD
HSKSECYDFFYFNFISCKYRLRGLDVYGADHIKGAKFFLERHRFFVVEDG
MMNYSKNMYAFSLFRTRNPVILPGGFHPNVKTIFLTKDNPIPDQIAHKRE
IINIKTLWQAKTATEKTKILSFFEIDMQEISVIKNRSFVLYTQPLSEDKL
LTEAEKIDIYRTILTKYNHSQTVIKPHPRDKTDYKQLFPDAYVMKGTYPS
ELLTLLGVNFNKVITLFSTAVFDYPKEKIDFYGTAVHPKLLDFFD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAAATTGCCATTATTAGCAATCAAAGAATGTTTTTTTTATATTG
TTTACTGACTAATAAAAATGTAGAGGACGTTTTCTTTATTTTTGAAAAAG
GCGCTATGCCGAATAATCTCACTAGCATATCTCATTTTATTGTGTTAGAT
CATTCTAAATCAGAATGTTATGATTTCTTCTATTTTAATTTTATATCCTG
TAAATATAGGTTACGTGGTTTAGATGTTTATGGTGCAGATCATATTAAAG
GCGCTAAGTTTTTTCTTGAAAGACACCGATTTTTTGTGGTGGAAGATGGA
ATGATGAATTATTCCAAAAATATGTATGCGTTCTCACTCTTTAGAACAAG
AAATCCGGTTATTTTGCCGGGTGGTTTTCATCCAAACGTAAAGACTATTT
TTTTGACCAAAGATAATCCGATCCCAGATCAAATTGCGCATAAAAGAGAA
ATCATTAATATCAAAACATTATGGCAAGCTAAGACGGCTACGGAAAAGAC
TAAAATACTTTCTTTTTTTGAAATAGATATGCAAGAAATATCCGTGATTA
AAAACAGAAGTTTTGTTCTCTATACGCAACCACTTTCGGAAGATAAACTT
CTGACAGAAGCAGAAAAGATTGATATATATCGTACTATTTTAACTAAATA
TAACCATTCACAAACGGTGATTAAACCGCATCCAAGAGATAAAACAGATT
ATAAACAACTGTTTCCTGATGCTTATGTGATGAAGGGCACTTACCCTTCA
GAATTATTAACTTTATTAGGTGTGAATTTTAATAAAGTCATTACGTTATT
TTCCACAGCAGTATTTGATTATCCTAAAGAAAAGATTGATTTTTATGGTA
CCGCGGTTCATCCAAAATTATTAGATTTTTTTGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy