Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR485 IGR479 IGR483 IGR478 IGR484 IGR481 IGR480 IGR486 IGR487 IGR482 yadR, - HD0684 HD0680 HD0682 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 rmlA, - HD0688 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 dnaG, - HD0690 gcr, - HD0678 yadR, - HD0684 HD0680 HD0682 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 rmlA, - HD0688 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 dnaG, - HD0690 gcr, - HD0678 yadR, - HD0684 HD0680 HD0682 HD0681 HD0681 rpS21,rpsU,rs21, - HD0689 neuA,siaB, - HD0685 rmlA, - HD0688 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 dnaG, - HD0690 gcr, - HD0678
* Calculated from Protein Sequence

Gene ID: HD0685

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
neuA  siaB  

Definition:
cytidine 5'monophosphate N-acetylneuraminic acid

Gene Start:
540593

Gene Stop:
541282

Gene Length:
690

Molecular Weight*:
25658

pI*:
6.30

Net Charge*:
-3.17

EC:
2.7.7.43  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Sugar-nucleotide biosynthesis and conversions  

Pathway: pathway table
Aminosugars metabolism

Primary Evidence:
Bozue JA, Tullius MV, Wang J, Gibson BW, Munson RS Jr.
Haemophilus ducreyi produces a novel sialyltransferase. Identification of the sialyltransferase gene and construction of mutants deficient in the production of
the sialic acid-containing glycoform of the lipooligosaccharide.
J Biol Chem. 1999 Feb 12;274(7):4106-14.
PMID: 9933604

Tullius,M.V., Munson,R.S. Jr., Wang,J. and Gibson,B.W.
Purification, cloning, and expression of a cytidine
5'-monophosphate N-acetylneuraminic acid synthetase from
Haemophilus ducreyi
J. Biol. Chem. 271 (26), 15373-15380 (1996)
MEDLINE: 96279048

Tullius MV, Vann WF, Gibson BW.
Covalent modification of Lys19 in the CTP binding site of cytidine
5'-monophosphate N-acetylneuraminic acid synthetase.
Protein Sci. 1999 Mar;8(3):666-75.
PMID: 10091669


Secondary Evidence:
Zapata,G., Vann,W.F., Aaronson,W., Lewis,M.S. and Moos,M.
Sequence of the cloned Escherichia coli K1 CMP-N-acetylneuraminic
acid synthetase gene
J. Biol. Chem. 264 (25), 14769-14774 (1989)
MEDLINE: 89359273

Ishige K, Hamamoto T, Shiba T, Noguchi T.
Novel method for enzymatic synthesis of CMP-NeuAc.
Biosci Biotechnol Biochem. 2001 Aug;65(8):1736-40.
PMID: 11577711


Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported 4741793 in GenBank.

Numerous significant hits in gapped BLAST to acylneuraminate cytidylyltransferase (also known as CMP-N-acetylneuraminic acid synthetase, CMP-Neu-NAc synthetase, and CMP-sialic acid synthetase); e.g., residues 3-225 are 64% similar to NEUA_HAEIN [2833483], residues 1-227 are 43% similar to NEU_NEIME [2833491], and residues 6-219 are 40% similar to the sequence for CMP-sialic acid synthetase in Campylobacter jejuni [6940837].

COGS Summary:  COGS Search
BeTs to 3 clades of COG1083
COG name: CMP-N-acetylneuraminic acid synthetase
Functional Class:  M
The phylogenetic pattern of COG1083 is -------c---hu--------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003329 (Cytidylyltransferase (CMP-NeuAc synthetase)) with a combined E-value of 9.8e-17.
    IPB003329A    8-25
    IPB003329B    48-65
    IPB003329C    158-172


ProDom Summary:  Protein Domain Search
Residues 11-116 are 33% similar to a (SYNTHETASE CYTIDYLYLTRANSFERASE) protein domain (PD007621) which is seen in O88719_MOUSE.

Residues 72-221 are identical to a (PROTEOME NEUA COMPLETE ACID) protein domain (PD401463) which is seen in O33868_HAEDU.

Residues 72-221 are 64% similar to a (SYNTHETASE ACID ACYLNEURAMINATE) protein domain (PD355822) which is seen in NEUA_HAEIN.

Residues 3-71 are 88% similar to a (SYNTHETASE ACID CYTIDYLYLTRANSFERASE) protein domain (PD228824) which is seen in O33868_HAEDU.



Paralogs:  Local Blast Search
HD0685 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 198 (E-value = 7.9e-38) place HD0685 in the CTP_transf_3 family which is described as Cytidylyltransferase (PF02348)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTMKKIAIIPARAGSKGIKDKNLQLVGGISLVGRAIIAAQQAGIFDHIIV
SSDGDHILKEAERYQAETLKRPSYLAQSETKSIDVILHALEALQFSDGIV
VLIQPTSPLRSEIDIKNAMALFLEGKYHAVISACECEHHPYKSFLLEQDN
IIPLTDINDFEVPRQKLPKSYRANGAIYINDIAALIQQKRFFVEPMQFYL
MPQDRSIDIDAIIDLKMAELLLQHEHAII$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGATGAAGAAGATTGCAATCATCCCTGCCCGTGCCGGCTCAAAAGG
TATCAAGGATAAAAACCTACAATTAGTTGGCGGTATTTCATTGGTTGGTC
GAGCGATTATCGCCGCTCAGCAAGCGGGTATTTTTGATCATATTATTGTC
AGTTCGGATGGCGATCATATTTTAAAAGAGGCGGAACGTTATCAAGCAGA
AACATTAAAGCGACCTTCTTATTTAGCGCAAAGTGAGACAAAAAGCATTG
ATGTGATCCTTCACGCTTTGGAGGCATTACAGTTTAGCGATGGAATAGTG
GTACTTATCCAACCAACTAGCCCGTTGCGATCAGAGATTGATATTAAAAA
CGCGATGGCACTTTTTTTAGAAGGGAAGTATCACGCTGTAATTTCTGCTT
GTGAATGTGAACATCATCCTTATAAAAGTTTTTTATTAGAACAGGATAAT
ATTATTCCATTAACAGATATCAACGATTTTGAAGTGCCACGACAAAAATT
ACCGAAATCCTATCGGGCAAATGGAGCGATTTATATCAATGATATTGCAG
CACTTATTCAACAAAAAAGATTTTTTGTTGAACCGATGCAGTTCTATTTG
ATGCCACAAGATCGTTCGATTGATATTGATGCAATTATTGATCTTAAAAT
GGCAGAGTTATTGCTACAACATGAGCATGCCATTATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy