Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR479 IGR483 IGR475 IGR478 IGR484 IGR481 IGR480 IGR476 IGR477 IGR482 metJ, - HD0675 yadR, - HD0684 HD0680 HD0682 panF, - HD0671 neuA,siaB, - HD0685 vacJ, - HD0677 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 gcr, - HD0678 metJ, - HD0675 yadR, - HD0684 HD0680 HD0682 panF, - HD0671 neuA,siaB, - HD0685 vacJ, - HD0677 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 gcr, - HD0678 metJ, - HD0675 yadR, - HD0684 HD0680 HD0682 panF, - HD0671 HD0681 HD0673 HD0681 HD0673 neuA,siaB, - HD0685 vacJ, - HD0677 lst, - HD0686 menA, - HD0683 rmlB, - HD0687 gcr, - HD0678
* Calculated from Protein Sequence

Gene ID: HD0680

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (possible periplasmic protein)

Gene Start:
538108

Gene Stop:
537431

Gene Length:
678

Molecular Weight*:
25039

pI*:
8.90

Net Charge*:
1.49

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 22-223 are 29% similar to >15603431 unknown [Pasteurella multocida].

Otherwise, one weak hit in gapped BLAST to a hypothetical protein in Neisseria meningitidis that is a putative periplasmic protein; residues 20-224 are 23% similar to a protein described as a hypothetical protein [7226084] or a putative periplasmic protein [7379755].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 22-174 are 30% similar to a (PROTEOME COMPLETE PERIPLASMIC PA4495) protein domain (PD339927) which is seen in Q9CKP3_PASMU.



Paralogs:  Local Blast Search
HD0680 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 17 to 223 (E-value = 2.2e-05) place HD0680 in the DUF541 family which is described as Protein of unknown function (DUF541) (PF04402)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MVTSITATANQMPANPPKTVFEFSTEINRTIEKDVMQAVVYSRKTGKQLP
DLKKSVSLHLNKVIDNAKKQSDIELEANGVRNFVNYDNNNKPDGWVAEGR
VYLKSKNFEALAKVLEQLDSEVAISDIYFSVSPEKAKTLENEMILDVLKQ
FKHKAEVVQAGLNAKNYVLTDVKLDTPNGNLDQFEVRSFAMMARSVRPAS
AKEELSLEPGKATLSARASGKVQFE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTAACAAGTATCACCGCTACCGCTAACCAAATGCCAGCGAATCCGCC
AAAAACCGTTTTTGAGTTTTCGACCGAGATTAATCGTACTATTGAAAAAG
ACGTAATGCAGGCTGTGGTTTATAGCCGTAAAACCGGCAAACAATTGCCT
GATCTCAAAAAATCTGTTTCTCTACATTTAAATAAAGTGATTGATAACGC
TAAAAAGCAATCTGATATTGAATTAGAAGCAAATGGCGTGCGTAATTTTG
TCAATTACGATAACAATAATAAACCGGACGGCTGGGTTGCTGAAGGACGT
GTGTACCTTAAAAGTAAAAACTTTGAAGCACTTGCAAAAGTATTAGAACA
ACTTGACTCAGAAGTAGCCATCAGTGATATCTATTTCAGCGTATCTCCAG
AAAAAGCAAAAACATTAGAAAATGAAATGATTTTAGATGTTCTAAAACAA
TTCAAACATAAAGCGGAAGTTGTGCAAGCGGGTCTAAATGCAAAAAATTA
TGTATTAACCGACGTTAAATTAGACACGCCAAATGGTAATCTTGATCAAT
TTGAAGTAAGAAGCTTCGCTATGATGGCAAGATCAGTCAGACCTGCTTCA
GCAAAAGAAGAGCTTTCACTTGAACCGGGTAAAGCAACCCTTTCTGCTCG
TGCATCTGGTAAAGTACAATTTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy