Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR479 IGR483 IGR475 IGR478 IGR481 IGR480 IGR474 IGR476 IGR477 IGR482 metJ, - HD0675 yadR, - HD0684 HD0680 HD0682 panF, - HD0671 neuA,siaB, - HD0685 vacJ, - HD0677 lst, - HD0686 menA, - HD0683 gcr, - HD0678 valS, - HD0669 metJ, - HD0675 yadR, - HD0684 HD0680 HD0682 panF, - HD0671 neuA,siaB, - HD0685 vacJ, - HD0677 lst, - HD0686 menA, - HD0683 gcr, - HD0678 valS, - HD0669 metJ, - HD0675 yadR, - HD0684 HD0680 HD0682 panF, - HD0671 HD0681 HD0673 HD0681 HD0673 vacJ, - HD0677 lst, - HD0686 menA, - HD0683 gcr, - HD0678 valS, - HD0669 neuA,siaB, - HD0685
* Calculated from Protein Sequence

Gene ID: HD0678

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gcr  

Definition:
site-specific recombinase

Gene Start:
535389

Gene Stop:
537359

Gene Length:
1971

Molecular Weight*:
74655

pI*:
9.70

Net Charge*:
18.60

EC:
 

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Rozsa,F.W., Meyer,T.F. and Fussenegger,M.
Inversion of Moraxella lacunata type 4 pilin gene sequences by a
Neisseria gonorrhoeae site-specific recombinase
J. Bacteriol. 179 (7), 2382-2388 (1997)
MEDLINE: 97234652


Comment:


Blast Summary:  PSI-Blast Search
Residues 3-650 are 58% similar to >15603333 unknown [Pasteurella multocida].

Otherwise, two strong hits in gapped BLAST to a site specific recombinase in Neisseria species; e.g., residues 6-650 are 44% similar to the sequence for site-specific recombinase in Neisseria meningitidis [7380133], and residues 228-650 are 50% similar to residues 1-426 of the sequence for site-specific recombinase in Neisseria gonorrhoeae [1923241].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 228-650 are 62% similar to a (PROTEOME RECOMBINASE SITE-SPECIFIC) protein domain (PD141117) which is seen in Q9CKY3_PASMU.

Residues 3-227 are 51% similar to a (PROTEOME COMPLETE RECOMBINASE) protein domain (PD359465) which is seen in Q9CKY3_PASMU.



Paralogs:  Local Blast Search
HD0678 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAKMYVDEQKLPAFIEYQVQQNDAFALLSGICKWLRKGSPHQAAAKLDFF
TTYLKQQPAVGQAVATLLCRWLCKMRLYPILVSGGILGREGFGREMRHRL
YEKINPAFKDVNDLRDVFFLLFRQRKDMQWMNAIPDKYWLSLLHCLDRFV
SEQDRNWLYDHIRHEGFFAIKMLSIWIAAEDLEPELIRLDPTLLDADSPF
VALQKEVGLWLNARHQHQYYDDSHLHVMLTQSRELVGRLQKKGETAGSSM
GVAYLLERLCQTLDRLAMLMDLLAAKRVARLRVLKITKMLAEAAANKHSI
SDLWKQSIKMLSRSITQQTSDHGEHYITRDKKEYFSMFFSAAGGGVLIAL
MALFKIYLGHIIDDKVWKGVAEGLNYGIGFAIIFMLHFTVATKQPAMTAS
RFAEAVERNSQGRAVNMKLAQLLVDVLRSQSAAVFGNVLVSVYVAAGIAY
LYASHMGQPLLTSEMVQYQLHSIDPTQGTLWFAAIAGLWLFCSGIISGYF
DNRSNYLNTRMRLRQHPVLKLLLPQRLRECLADYIHDNSGSIIGNICFGM
LLGLTGVIGYWLDLPLDIRHVAFSSANVGYAVVSDQLGWQIFMQSLGFVL
LIGVVNLIVSFSLTLWVALRSRNTEIDSWTAILKCICEIVRKRPLSLLLP
FQLHHK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAAATGTATGTAGATGAACAAAAATTGCCCGCTTTTATTGAATA
TCAAGTTCAACAAAATGATGCGTTTGCACTATTAAGTGGTATTTGCAAAT
GGTTACGCAAAGGTAGCCCACACCAAGCGGCAGCAAAATTAGATTTTTTT
ACCACGTATTTAAAACAACAACCGGCTGTTGGACAAGCCGTTGCAACATT
ATTGTGTCGTTGGTTATGCAAAATGCGACTTTATCCGATTCTAGTGAGTG
GCGGTATTTTAGGTAGAGAAGGGTTTGGCAGAGAAATGCGACATCGCCTA
TATGAAAAAATTAATCCGGCGTTTAAAGATGTCAATGATTTACGGGACGT
TTTTTTCTTGTTATTCCGCCAACGTAAAGATATGCAATGGATGAATGCCA
TTCCAGATAAATATTGGCTGTCATTATTGCATTGTTTAGATCGTTTTGTT
AGTGAACAAGATCGCAATTGGTTATACGATCATATTCGCCACGAAGGATT
TTTTGCGATTAAAATGCTGTCCATTTGGATTGCTGCGGAAGATTTAGAGC
CTGAATTAATTCGGTTGGATCCAACATTACTGGATGCAGATTCGCCATTC
GTGGCATTACAAAAAGAAGTCGGGTTGTGGTTAAATGCTCGCCATCAACA
TCAGTATTACGATGATAGTCATTTACACGTTATGTTGACGCAATCGCGAG
AATTAGTTGGCCGTTTGCAAAAGAAAGGAGAAACCGCGGGATCTTCAATG
GGCGTAGCATATTTATTAGAACGCTTATGCCAAACCTTAGATCGTTTAGC
CATGTTGATGGACTTGTTAGCGGCAAAACGCGTTGCTAGGTTAAGAGTAT
TGAAAATTACGAAAATGTTAGCAGAAGCAGCGGCAAATAAACACAGTATT
TCGGACTTATGGAAACAGAGCATTAAAATGCTTTCTCGCAGTATTACTCA
GCAAACGAGTGATCACGGTGAACACTATATTACACGCGATAAGAAAGAAT
ATTTTAGTATGTTTTTTTCTGCCGCAGGCGGTGGAGTATTAATTGCATTA
ATGGCGCTGTTTAAAATTTATTTAGGTCATATTATTGATGATAAAGTTTG
GAAGGGCGTGGCTGAAGGTCTGAATTATGGCATTGGTTTTGCCATTATTT
TTATGTTGCATTTTACGGTTGCTACAAAACAGCCTGCAATGACCGCTTCT
CGCTTTGCTGAGGCGGTCGAACGAAATTCACAAGGTAGAGCAGTGAATAT
GAAATTAGCACAATTATTAGTGGATGTATTGCGTTCGCAAAGTGCGGCGG
TATTTGGGAATGTATTGGTGTCAGTTTATGTTGCTGCAGGTATTGCTTAT
CTCTATGCCTCTCACATGGGGCAGCCGTTGTTAACATCAGAGATGGTGCA
ATATCAGTTACATTCTATTGATCCCACGCAAGGCACACTGTGGTTTGCGG
CTATTGCCGGCTTATGGTTGTTTTGTTCGGGTATTATTTCCGGTTATTTT
GATAATCGCAGTAATTATTTAAACACGCGTATGCGATTACGTCAGCATCC
AGTGTTGAAATTATTATTACCACAACGCTTACGTGAGTGTTTAGCTGATT
ATATCCATGATAATTCTGGATCTATTATCGGTAATATATGCTTTGGTATG
TTATTAGGTTTAACGGGGGTGATAGGTTATTGGTTAGATTTACCATTAGA
TATCCGCCACGTCGCCTTTTCATCAGCCAATGTTGGTTATGCGGTGGTTA
GCGATCAGTTAGGTTGGCAAATTTTTATGCAGAGCTTAGGTTTTGTATTA
TTAATTGGTGTGGTCAATTTAATTGTGAGTTTTTCCTTGACGTTATGGGT
GGCATTACGTTCACGTAATACTGAGATTGATAGTTGGACCGCTATTTTGA
AATGTATTTGTGAGATTGTGCGAAAACGGCCATTGAGTTTATTGTTACCG
TTCCAATTACATCATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy