Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR470 IGR473 IGR475 IGR472 IGR469 IGR474 IGR476 IGR477 IGR471 HD0664 metJ, - HD0675 HD0665 tig, - HD0663 panF, - HD0671 holC, - HD0667 vacJ, - HD0677 HD0668 gcr, - HD0678 valS, - HD0669 HD0664 metJ, - HD0675 HD0665 tig, - HD0663 panF, - HD0671 holC, - HD0667 vacJ, - HD0677 HD0668 gcr, - HD0678 valS, - HD0669 HD0665 tig, - HD0663 panF, - HD0671 HD0673 metJ, - HD0675 HD0664 HD0673 holC, - HD0667 vacJ, - HD0677 HD0668 gcr, - HD0678 valS, - HD0669
* Calculated from Protein Sequence

Gene ID: HD0669

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
valS  

Definition:
valyl-tRNA synthetase, valS

Gene Start:
529204

Gene Stop:
532089

Gene Length:
2886

Molecular Weight*:
108972

pI*:
5.70

Net Charge*:
-15.25

EC:
6.1.1.9  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Secondary Evidence:

Tardif KD, Horowitz J.
Transfer RNA determinants for translational editing by Escherichia coli valyl-tRNA synthetase.
Nucleic Acids Res. 2002 Jun 1;30(11):2538-45.
PMID: 12034843

Tardif KD, Liu M, Vitseva O, Hou YM, Horowitz J.
Misacylation and editing by Escherichia coli valyl-tRNA synthetase: evidence for two tRNA binding sites.
Biochemistry. 2001 Jul 10;40(27):8118-25.
PMID: 11434781

Comment:


Blast Summary:  PSI-Blast Search
Many very strong hits in gapped BLAST to valyl-tRNA synthetases; e.g., residues 1-961 are 85% similar to SYV_HAEIN [1174549], residues 7-961 are 68% similar to SYV_ECOLI [2507438], and residues 7-961 are 67% similar to the sequence for valyl-tRNA synthetase in Vibrio cholerae [9657085].

COGS Summary:  COGS Search
BeTs to 17 clades of COG0525
COG name: Valyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0525 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 7e-10.
    IPB001412A    48-58
    IPB001412B    557-567


ProDom Summary:  Protein Domain Search
Residues 713-806 are 73% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA ATP-BINDING) protein domain (PD001183) which is seen in Q9CMK5_PASMU.

Residues 705-745 are 68% similar to a (LIGASE SYNTHETASE ATP-BINDING VALYL-TRNA) protein domain (PD410207) which is seen in SYV_ECOLI.

Residues 122-181 are 81% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA ATP-BINDING) protein domain (PD002670) which is seen in SYV_ECOLI.

Residues 870-959 are 77% similar to a (SYNTHETASE LIGASE VALYL-TRNA) protein domain (PD004138) which is seen in SYV_HAEIN.

Residues 704-786 are 40% similar to a (SYNTHETASE LIGASE ISOLEUCYL-TRNA) protein domain (PD023651) which is seen in SYV_BACSU.

Residues 618-695 are identical to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000476) which is seen in SYV_HAEIN.

Residues 355-532 are 92% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000647) which is seen in Q9CMK5_PASMU.

Residues 183-354 are 87% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD004139) which is seen in SYV_HAEIN.

Residues 15-98 are 91% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000389) which is seen in SYV_HAEIN.

Residues 407-453 are 62% similar to a (LIGASE SYNTHETASE ATP-BINDING VALYL-TRNA) protein domain (PD382343) which is seen in SYV_BACSU.

Residues 809-868 are 58% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD402875) which is seen in Q9CMK5_PASMU.

Residues 711-865 are 70% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD347709) which is seen in SYV_HAEIN.



Paralogs:  Local Blast Search
HD0669 is paralogously related to HD0272 (6e-43) and HD1132 (7e-23).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1GAX|A Chain A, Crystal Structure Of Thermus Thermophilus V... 660 0.0
pdb|1ILE| Isoleucyl-Trna Synthetase 210 8e-055
pdb|1FFY|A Chain A, Insights Into Editing From An Ile-Trna Synt... 177 6e-045

Gene Protein Sequence:
MTQKFEMADRFDASAVEQALYQHWEEQGYFKPSENPAVPSYCIAIPPPNV
TGSLHMGHAFQQTLMDTLIRFNRMEGNNTLWQAGTDHAGIATQMVVERKI
AAEEGKTRHDYGREAFINKIWDWKAYSGGTISQQMRRLGNSIDWQRERFT
MDDGLSNAVKEVFVRLHEQGLIYRGKRLVNWDPKLHTAISDLEVENKESK
GSLWHFRYPLSNGVKTADGKDYLIVATTRPETVLGDTAVAVHPEDERYQS
LIGKTVLLPLANREIPIIADEYVDREFGTGVVKITPAHDFNDYEVGKRHA
LPMVNVMTMNADIRQTAEVLGPDGKPLNTYQAIIPADYQGLERFTARKKV
VADFEALALLDEIKPHDLKVPYGDRGGVPIEPMLTDQWYVSVKPLAEVAT
KAVENGEIQFVPKQYENLYFSWMRDIQDWCISRQLWWGHRIPAWYDESGN
VYVARTEAEVRIKHNLPLDLPLTQDEDVLDTWFSSGLWTFSTLGWPEQTK
ELKMFHTTDVLITGFDIIFFWVARMIMFTMHFIKDENGKPQVPFKTVYVT
GLIRDEQGQKMSKSKGNVLDPIDMIDGISLADLLEKRTGNMMQPQLAEKI
AKATRKEFAATPTLPAGGIAAHGTDALRFTLAALASNGRDINWDMKRLEG
YRNFCNKLWNASRFVLTNDKLDLSAGEVEYSLADRWIESSFNRTVGEFRE
ALTQYRFDLAANAIYEFTWNQFCDWYLELTKPVFANGSDAQKRATSKTLV
SLLEKLLRLAHPIMPFITEEIWQKVKHFAGVEGDSIMLQPFPIVEQAKLD
ADAEQQINWLKELIIAVRNIRAEANIAPSKALDLLVRNVTQQQAVILSEN
QLLLTAMAKLTSISVLTAGEQAPLSVAKLVGQVEVLVPMAGFINKDTELA
RLSKEIDKLHNEVMRIESKLSNEAFVAKAPEAVISKERAKMAEYQSGIEK
LQAQFKAIEAL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACAAAAATTTGAAATGGCAGATCGCTTTGATGCATCGGCGGTAGA
GCAAGCACTTTATCAGCACTGGGAAGAACAGGGGTATTTTAAACCTTCTG
AAAATCCAGCGGTACCAAGCTACTGCATTGCCATTCCACCACCAAATGTA
ACAGGTTCATTACATATGGGGCATGCTTTCCAACAAACATTAATGGATAC
GTTGATCCGTTTTAATCGAATGGAAGGCAATAACACATTATGGCAGGCGG
GTACTGATCACGCGGGTATTGCTACACAAATGGTCGTTGAGCGTAAAATT
GCCGCTGAAGAAGGCAAAACACGCCACGATTATGGGCGTGAAGCATTTAT
CAATAAAATTTGGGATTGGAAGGCCTATTCAGGCGGTACTATTAGCCAAC
AAATGCGTCGTTTAGGTAATTCAATTGATTGGCAACGTGAACGTTTTACG
ATGGATGATGGTTTATCCAATGCGGTTAAAGAAGTATTTGTTCGTTTGCA
CGAACAAGGTTTGATTTATCGTGGTAAGCGTTTAGTCAATTGGGATCCAA
AATTACACACGGCGATTTCTGACTTAGAAGTAGAAAACAAAGAAAGCAAA
GGCTCACTTTGGCATTTCCGTTATCCATTATCGAATGGCGTGAAAACGGC
AGATGGTAAAGATTATTTGATTGTTGCCACGACACGTCCTGAAACGGTAT
TGGGGGATACGGCAGTTGCAGTTCATCCTGAAGATGAGCGTTATCAATCA
TTAATTGGTAAAACGGTTTTATTACCGCTTGCTAACCGTGAGATTCCAAT
TATTGCGGATGAATATGTTGATCGTGAATTTGGCACGGGGGTGGTGAAGA
TTACCCCCGCTCACGATTTTAACGACTATGAAGTCGGTAAGCGTCATGCT
TTGCCGATGGTCAATGTAATGACGATGAATGCGGATATTCGTCAAACTGC
CGAAGTACTTGGTCCTGATGGTAAACCGCTTAACACTTATCAAGCAATTA
TTCCGGCTGATTATCAAGGTTTGGAACGTTTTACGGCACGTAAAAAGGTG
GTTGCTGATTTTGAAGCATTGGCATTATTAGATGAAATTAAACCGCATGA
TTTAAAAGTGCCTTATGGTGACCGTGGTGGCGTTCCGATTGAGCCGATGC
TAACAGATCAATGGTATGTAAGTGTAAAACCGCTTGCTGAAGTTGCTACA
AAAGCGGTGGAAAATGGTGAAATTCAATTTGTGCCAAAACAATATGAAAA
TCTCTATTTCTCTTGGATGCGTGATATTCAAGATTGGTGTATTTCTCGTC
AATTGTGGTGGGGACATCGTATACCGGCTTGGTATGATGAAAGTGGCAAT
GTGTATGTAGCGCGTACGGAAGCAGAAGTTCGTATTAAGCATAATTTACC
GCTTGATTTACCATTAACACAAGATGAAGACGTATTGGACACGTGGTTCT
CATCTGGTTTATGGACATTCTCAACGTTAGGCTGGCCAGAACAAACAAAA
GAATTGAAAATGTTTCATACAACGGATGTGTTGATCACTGGGTTTGATAT
TATTTTCTTCTGGGTTGCGCGTATGATTATGTTTACGATGCACTTCATCA
AAGATGAAAATGGTAAACCGCAAGTACCATTTAAAACGGTGTATGTAACC
GGGCTGATTCGTGATGAACAAGGTCAAAAAATGTCGAAATCGAAAGGCAA
TGTTTTAGATCCGATTGATATGATCGATGGCATTAGTCTTGCAGATTTGC
TAGAAAAACGCACCGGTAATATGATGCAACCACAATTAGCAGAGAAAATT
GCTAAAGCGACCCGTAAAGAATTTGCTGCTACACCAACGTTACCGGCAGG
CGGTATTGCGGCTCACGGTACGGACGCATTACGTTTTACATTGGCGGCAT
TAGCCTCAAATGGGCGTGATATTAACTGGGATATGAAGCGTTTAGAGGGC
TATCGCAATTTCTGTAATAAATTATGGAATGCTAGCCGTTTTGTACTGAC
CAACGACAAATTAGATCTATCAGCTGGCGAAGTAGAGTATTCATTAGCGG
ATCGTTGGATTGAATCAAGTTTTAACCGTACTGTGGGTGAATTCCGTGAA
GCATTAACACAATACCGTTTTGATTTAGCAGCCAATGCGATTTATGAATT
CACTTGGAACCAATTCTGCGATTGGTATTTAGAATTAACTAAACCGGTAT
TTGCTAATGGCAGTGATGCACAAAAACGAGCCACCAGTAAAACATTAGTT
AGCTTATTAGAAAAGCTGTTGCGATTAGCCCACCCAATTATGCCATTTAT
AACTGAAGAAATTTGGCAGAAAGTTAAACATTTTGCAGGTGTGGAAGGCG
ATAGCATTATGTTGCAACCATTCCCAATAGTCGAACAAGCAAAATTGGAT
GCTGATGCCGAGCAACAAATTAATTGGCTGAAAGAGTTGATTATTGCCGT
ACGTAATATTCGGGCAGAAGCGAATATTGCACCAAGTAAAGCATTAGATC
TGTTAGTGCGTAATGTAACGCAACAACAAGCGGTTATATTAAGTGAAAAT
CAATTATTACTGACAGCAATGGCAAAATTAACCTCTATTTCTGTGTTAAC
TGCGGGCGAACAAGCCCCGCTTTCTGTCGCTAAATTAGTTGGTCAAGTGG
AAGTATTAGTGCCAATGGCTGGTTTTATTAATAAAGATACGGAATTAGCC
CGCTTAAGCAAGGAAATTGATAAGCTACATAATGAAGTGATGCGTATTGA
AAGCAAGTTGAGTAATGAAGCCTTTGTTGCAAAAGCGCCTGAAGCTGTGA
TTAGCAAAGAGCGTGCTAAAATGGCGGAATACCAAAGCGGTATTGAAAAA
TTACAAGCGCAATTTAAAGCGATTGAAGCGCTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy