Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR467 IGR470 IGR473 IGR472 IGR469 IGR474 IGR468 IGR466 IGR471 HD0664 HD0665 HD0662 secB, - HD0661 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 holC, - HD0667 HD0668 valS, - HD0669 HD0664 HD0665 HD0662 secB, - HD0661 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 holC, - HD0667 HD0668 valS, - HD0669 HD0665 HD0662 secB, - HD0661 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 HD0673 HD0673 HD0664 holC, - HD0667 HD0668 valS, - HD0669
* Calculated from Protein Sequence

Gene ID: HD0668

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
528290

Gene Stop:
529162

Gene Length:
873

Molecular Weight*:
33233

pI*:
5.80

Net Charge*:
-1.17

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
One weak hit in gapped BLAST to a hypothetical protein in Synechocystis species; e.g., residues 115-259 are 32% similar to the sequence for hypothetical protein sll1439 in Synechocystis species [7452237].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 115-240 are 34% similar to a (PROTEOME COMPLETE) protein domain (PD123803) which is seen in P74213_SYNY3.



Paralogs:  Local Blast Search
HD0668 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLNYTEGTMAIVESTIKSIDLIKGEIIINKLNDKQKKDFICKKEFYIKYL
EVSQLDTLKEGDSVSFIAIEKAGNYYANNIKLIQSNEAAIMPNVKCERSI
LMFTNKFIKELESTLASISSSEDFEDFTLFVLKSLGISEIYAVPRNNAAG
RADGVFKVSNISNNTPKLEVIYDCTLYSGWEEKKKQQIANYVTQICRNSM
NIDYEFIERYITKKIKTSISFNNNSEKQIWIITKNATRTISEEQLENSES
DLLVKVREINISDLIKLLAKKLLDTKYIKIDDIANELKNL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAATTATACAGAGGGAACTATGGCTATAGTAGAATCTACTATTAA
ATCTATAGATTTAATAAAAGGTGAAATAATCATCAATAAATTAAATGATA
AGCAAAAAAAAGATTTCATTTGTAAAAAAGAATTTTATATTAAGTATTTA
GAAGTCTCGCAACTGGATACTTTAAAAGAAGGCGATAGCGTTTCATTTAT
AGCTATAGAAAAAGCGGGTAACTATTATGCTAATAATATAAAACTTATTC
AAAGTAATGAAGCAGCTATTATGCCAAACGTTAAGTGTGAACGTAGTATT
TTGATGTTTACTAATAAATTTATTAAAGAATTAGAGTCAACTTTAGCTAG
TATTTCGAGTAGTGAAGATTTTGAAGATTTCACTTTATTTGTATTAAAGT
CCTTAGGGATATCTGAAATTTATGCAGTGCCAAGAAATAATGCAGCAGGT
AGGGCAGATGGCGTATTTAAAGTTTCAAATATCTCTAATAATACACCTAA
ATTAGAAGTTATTTATGATTGTACGCTTTATTCTGGATGGGAAGAGAAGA
AAAAGCAGCAGATTGCTAATTATGTAACCCAGATTTGCAGAAATTCGATG
AATATAGATTATGAGTTTATTGAGCGGTATATAACAAAAAAAATTAAAAC
ATCAATTTCATTTAATAATAATTCTGAGAAACAAATTTGGATAATAACAA
AGAACGCTACAAGAACTATTTCAGAAGAACAGTTAGAGAATTCAGAAAGT
GATTTGTTGGTTAAGGTTAGGGAAATAAATATTTCGGATTTAATTAAACT
ATTAGCAAAAAAATTATTAGATACTAAATATATAAAAATTGATGATATTG
CAAATGAACTGAAAAATCTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy