Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR465 IGR467 IGR470 IGR473 IGR472 IGR469 IGR474 IGR468 IGR466 IGR471 HD0664 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 holC, - HD0667 HD0668 valS, - HD0669 HD0664 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 holC, - HD0667 HD0668 valS, - HD0669 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 HD0664 holC, - HD0667 HD0668 valS, - HD0669
* Calculated from Protein Sequence

Gene ID: HD0667

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
holC  

Definition:
DNA polymerase III, chi subunit

Gene Start:
527766

Gene Stop:
528227

Gene Length:
462

Molecular Weight*:
17719

pI*:
5.10

Net Charge*:
-3.66

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Xiao,H., Crombie,R., Dong,Z., Onrust,R. and O'Donnell,M.
DNA polymerase III accessory proteins. III. holC and holD encoding
chi and psi
J. Biol. Chem. 268 (16), 11773-11778 (1993)
Medline: 93280138

Carter,J.R., Franden,M.A., Lippincott,J.A. and McHenry,C.S.
Identification, molecular cloning and characterization of the gene
encoding the chi subunit of DNA polymerase III holoenzyme of
Escherichia coli
Mol. Gen. Genet. 241 (3-4), 399-408 (1993)
Medline: 94067022

O'Donnell,M.
Accessory protein function in the DNA polymerase III holoenzyme
from E. coli
Bioessays 14 (2), 105-111 (1992)
Medline: 92246902



Comment:
From Genbank:[gi:1170335]
DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity.

For other "hol" genes, see HD1130 (holA), HD1935 (holB).

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to DNA polymerase III, chi subunit; residues 40-151 are 66% similar to HOLC_HAEIN [1170335], residues 9-150 are 51% similar to HOLC_ECOLI [123454], and residues 43-150 are 40% similar to the sequence of DNA polymerase III, chi subunit, in Vibrio cholerae [9657084].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 13-148 are 64% similar to a (DNA POLYMERASE SUBUNIT CHI) protein domain (PD021469) which is seen in Q9CMK2_PASMU.

Residues 43-150 are 40% similar to a (III PROTEOME SUBUNIT COMPLETE) protein domain (PD398238) which is seen in Q9KP74_VIBCH.



Paralogs:  Local Blast Search

HD0667 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 153 (E-value = 6.5e-65) place HD0667 in the DNA_pol3_chi family which is described as DNA polymerase III chi subunit, HolC (PF04364)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LWPSSRDSVKQVKFYLLSQLGSDDLSAAEAMACELAAQAWRSGKRVLIAC
ETEQQALNIDEALWAREPDSFVPHNLAGEFTQYATPIEICWQNKRNAQRR
DFLISLQTNLPDYINTFTQIIDFVPIDEKEKVHARERYKQYRQLGWQLVT
EQA$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTGGCCTTCTTCAAGGGATAGTGTGAAACAAGTTAAATTCTATTTACT
GAGCCAATTAGGCAGTGATGATCTTTCTGCTGCTGAAGCAATGGCGTGTG
AATTAGCTGCACAAGCTTGGCGATCGGGAAAGCGAGTATTAATTGCTTGT
GAAACAGAACAACAAGCCTTAAATATTGATGAAGCCTTATGGGCGCGTGA
GCCTGATTCATTTGTACCGCATAACCTAGCGGGTGAATTTACACAATATG
CAACACCGATTGAAATCTGTTGGCAAAACAAACGGAATGCACAACGTCGC
GATTTTCTGATTTCATTACAAACAAACTTGCCTGATTATATTAATACTTT
TACCCAAATCATTGACTTTGTACCCATAGATGAAAAGGAAAAGGTCCACG
CGCGTGAACGGTATAAGCAATACCGGCAATTAGGTTGGCAATTAGTGACT
GAACAGGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy