Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR465 IGR467 IGR470 IGR473 IGR472 IGR469 IGR474 IGR468 IGR466 IGR464 IGR471 HD0664 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 holC, - HD0667 HD0668 tufB, - HD0658 valS, - HD0669 HD0664 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 holC, - HD0667 HD0668 tufB, - HD0658 valS, - HD0669 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 panF, - HD0671 HD0664 holC, - HD0667 HD0668 tufB, - HD0658 valS, - HD0669
* Calculated from Protein Sequence

Gene ID: HD0665

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
527516

Gene Stop:
527073

Gene Length:
444

Molecular Weight*:
15795

pI*:
5.30

Net Charge*:
-3.28

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-147 are 55% similar to >15603839 unknown [Pasteurella multocida].

Otherwise, several weak hits in gapped BLAST to an assortment of poorly defined proteins; residues 1-146 are 33% similar to UP04_ECOLI, an unknown protein isolated from 2D-PAGE (spot LM6) [2506736], residues 66-144 are 36% similar to a hypothetical protein in Deinococcus radiodurans [7472597], residues 96-145 are 42% similar to residues 177-235 of XKDP_BACSU, phage-like element PBSX protein xkdP [1722873], and residues 96-145 are 40% similar to residues 161-219 of YQBP_BACSU, a hypothetical 25.3 kD protein in the spoIIIC-cwlA intergenic region [1176755].

COGS Summary:  COGS Search
BeTs to 4 clades of COG1652
COG name: Uncharacterized BCR
Functional Class: S
The phylogenetic pattern of COG1652 is --------eB------ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 97-144 are 77% similar to a (PROTEOME COMPLETE SECRETED PBSX) protein domain (PD351070) which is seen in Q9CJM3_PASMU.

Residues 1-83 are 45% similar to a (PROTEOME COMPLETE SPOT 2D-PAGE) protein domain (PD066397) which is seen in Q9CJM3_PASMU.



Paralogs:  Local Blast Search
HD0665 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 22 to 85 (E-value = 8.1e-11) place HD0665 in the BON family which is described as Putative phospholipid-binding domain (PF04972)
Residues 96 to 144 (E-value = 7.8e-10) place HD0665 in the LysM family which is described as LysM domain (PF01476)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGLFDFAANIGKKLFTKEEDASQAVTKHLTDDNPGVENVQVTVENGVAHL
TGIAATAAAIEKAVLMAGNIEGIANVNVDGVHIANGEKIASDDQFYIIQK
GDTLWEIASKAYGNGAKYKMIVEANKQVIKDENKIFPGQKIRIPKDL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTTTATTTGATTTTGCTGCTAATATCGGTAAAAAATTATTTACTAA
AGAAGAAGATGCTTCCCAAGCAGTCACTAAACATTTAACTGACGATAATC
CAGGTGTAGAAAATGTGCAAGTTACTGTAGAAAACGGTGTAGCGCATTTA
ACCGGTATTGCGGCGACTGCTGCTGCAATAGAAAAAGCGGTATTAATGGC
AGGCAACATTGAAGGTATTGCTAATGTAAACGTTGACGGTGTTCACATCG
CCAATGGTGAAAAAATCGCTAGTGATGATCAATTTTATATCATTCAAAAA
GGCGATACCTTATGGGAAATTGCTAGCAAAGCATACGGCAATGGCGCAAA
ATATAAAATGATTGTTGAAGCCAATAAACAAGTGATCAAAGACGAAAATA
AAATTTTTCCAGGTCAAAAAATCCGTATTCCAAAAGACTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy