Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR465 IGR467 IGR470 IGR463 IGR472 IGR469 IGR462 IGR468 IGR466 IGR464 IGR471 HD0664 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 holC, - HD0667 rpS7, - HD0656 HD0668 tufB, - HD0658 fusA, - HD0657 HD0664 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 holC, - HD0667 rpS7, - HD0656 HD0668 tufB, - HD0658 fusA, - HD0657 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 HD0664 holC, - HD0667 rpS7, - HD0656 HD0668 tufB, - HD0658 fusA, - HD0657
* Calculated from Protein Sequence

Gene ID: HD0660

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gpsA  

Definition:
glycerol-3-phosphate dehydrogenase

Gene Start:
524323

Gene Stop:
523313

Gene Length:
1011

Molecular Weight*:
36563

pI*:
8.40

Net Charge*:
4.27

EC:
1.1.1.8  

Functional Class:
Energy metabolism; Aerobic respiration  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Arcari,P., Russo,A.D., Ianniciello,G., Gallo,M. and Bocchini,V.
Nucleotide sequence and molecular evolution of the gene coding for
glyceraldehyde-3-phosphate dehydrogenase in the thermoacidophilic
archaebacterium Sulfolobus solfataricus
Biochem. Genet. 31 (5-6), 241-251 (1993)
MEDLINE: 94082761

Jones,C.E., Fleming,T.M., Cowan,D.A., Littlechild,J.A. and
Piper,P.W.
The phosphoglycerate kinase and glyceraldehyde-3-phosphate
dehydrogenase genes from the thermophilic archaeon Sulfolobus
solfataricus overlap by 8-bp. Isolation, sequencing of the genes
and expression in Escherichia coli
Eur. J. Biochem. 233 (3), 800-808 (1995)
MEDLINE: 96085144

Shimizu H, Nishiyama K, Tokuda H.
Expression of gpsA encoding biosynthetic sn-glycerol 3-phosphate dehydrogenase suppresses both the LB- phenotype of a secB null mutant and the cold-sensitive phenotype of a secG null mutant.
Mol Microbiol. 1997 Dec;26(5):1013-21.
PMID: 9426138



Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glycerol-3-phosphate dehydrogenase proteins; e.g., residues 1-336 are 71% similar to GPDA_HAEIN [1169998], residues 9-336 are 64% similar to GPDA_ECOLI [585215], and residues 9-336 are 63% similar to the sequence for glycerol-3-phosphate dehydrogenase in Vibrio cholerae [9657243].

COGS Summary:  COGS Search
BeTs to 14 clades of COG0240
COG name: Glycerol 3-phosphate dehydrogenase
Functional Class: C
The phylogenetic pattern of COG0240 is a-t-YqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001652 (NAD-dependent glycerol-3-phosphate dehydrogenase) with a combined E-value of 4.5e-43.
    IPB001652A    9-26
    IPB001652C    42-87
    IPB001652E    137-153
    IPB001652F    188-227
    IPB001652G    240-261
    IPB001652H    276-312


ProDom Summary:  Protein Domain Search
Residues 8-328 are 72% similar to a (NAD DEHYDROGENASE OXIDOREDUCTASE) protein domain (PD001649) which is seen in Q9CL17_PASMU.



Paralogs:  Local Blast Search

HD0660 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 328 (E-value = 3.8e-137) place HD0660 in the NAD_Gly3P_dh family which is described as NAD-dependent glycerol-3-phosphate dehydrogenase (PF01210)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTTDDTRPIAVLGAGSYGTALAIALARNGQRTHLWGHNPDKMVKMAEQRM
NTESLPAIPFPNALIIEKVLAHTLQQAQDILIVVPSHAFADILHQIKPLL
TTQHRIMWATKGLEHNTGRLLQTVATEIIGEQHPFAVLSGPTFAKELALG
LPTAITLASHDAKFADEMQQRIHCSKAFRVYLNTDMIGVQLGGAIKNVIA
IGAGISDGMGFGANARTALITRGLAEISRLGESLGANPKTFMGMAGLGDL
VLTCTDNQSRNRRFGLALGQGKSAEQAIAEIGQVVEGFYNTKETYLLAQR
QNIEMPIVEQIYQMLFCNKNANDVVTSLLERQRKKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTACAGACGACACTAGACCCATTGCTGTACTTGGTGCAGGTTCTTA
TGGCACCGCACTTGCAATAGCACTTGCGCGTAATGGACAACGGACTCACC
TTTGGGGACATAATCCCGATAAAATGGTTAAAATGGCTGAACAACGTATG
AATACAGAATCTCTGCCAGCAATACCATTTCCTAACGCATTAATTATTGA
AAAAGTATTAGCGCACACACTGCAACAAGCGCAAGATATATTAATTGTCG
TTCCAAGCCACGCTTTCGCCGATATCCTACACCAAATAAAACCGCTCTTA
ACGACACAACATCGGATTATGTGGGCAACGAAAGGACTAGAACATAATAC
AGGCCGACTATTACAAACTGTTGCAACAGAAATAATAGGAGAGCAACATC
CATTTGCAGTCTTATCTGGCCCTACATTTGCCAAAGAATTAGCCTTAGGC
TTACCGACTGCCATTACATTAGCCTCACACGATGCAAAATTCGCAGATGA
AATGCAACAACGAATCCATTGCTCAAAAGCATTTAGAGTTTACCTAAATA
CTGATATGATTGGCGTCCAACTAGGTGGCGCGATCAAAAATGTTATCGCG
ATTGGTGCAGGCATTTCAGATGGAATGGGGTTTGGCGCCAATGCACGAAC
AGCACTTATTACTAGAGGGCTCGCCGAAATCAGCCGTTTAGGCGAATCTT
TAGGTGCAAATCCAAAAACGTTTATGGGAATGGCCGGATTGGGCGACTTA
GTCTTAACGTGTACAGATAACCAATCACGAAATCGCCGTTTTGGCTTAGC
ATTAGGCCAAGGCAAATCAGCAGAACAAGCGATTGCTGAAATTGGACAAG
TTGTAGAAGGTTTTTATAATACAAAAGAAACCTATCTATTAGCACAACGT
CAAAACATTGAAATGCCAATTGTAGAACAAATCTACCAAATGCTCTTTTG
CAACAAAAATGCCAACGACGTTGTTACCAGCCTACTTGAACGGCAACGAA
AAAAGGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy