Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR465 IGR467 IGR470 IGR463 IGR469 IGR462 IGR461 IGR468 IGR466 IGR464 IGR471 HD0664 HD0654 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 rpS12,strA, - HD0655 holC, - HD0667 rpS7, - HD0656 tufB, - HD0658 fusA, - HD0657 HD0664 HD0654 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 rpS12,strA, - HD0655 holC, - HD0667 rpS7, - HD0656 tufB, - HD0658 fusA, - HD0657 HD0654 HD0665 HD0662 secB, - HD0661 cysE, - HD0659 gpsA, - HD0660 tig, - HD0663 HD0664 rpS12,strA, - HD0655 holC, - HD0667 rpS7, - HD0656 tufB, - HD0658 fusA, - HD0657
* Calculated from Protein Sequence

Gene ID: HD0659

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cysE  

Definition:
serine acetyltransferase

Gene Start:
523301

Gene Stop:
522486

Gene Length:
816

Molecular Weight*:
29818

pI*:
6.20

Net Charge*:
-5.11

EC:
2.3.1.30  

Functional Class:
Amino acid biosynthesis; Glycine-serine family  

Pathway: pathway table
Cysteine metabolism
Sulfur metabolism

Secondary Evidence:
Denk,D. and Bock,A.
L-cysteine biosynthesis in Escherichia coli: nucleotide sequence
and expression of the serine acetyltransferase (cysE) gene from the wild-type and a cysteine-excreting mutant
Journal of general microbiology. 133 (Pt 3), 515-525 (1987)
MEDLINE: 88009872

Tei,H., Murata,K. and Kimura,A.
Structure and expression of cysX, the second gene in the
Escherichia coli K-12 cysE locus
Biochemical and biophysical research communications. 167 (3),
948-955 (1990)
MEDLINE: 90211342


Wigley,D.B., Derrick,J.P. and Shaw,W.V.
The serine acetyltransferase from Escherichia coli.
Over-expression, purification and preliminary crystallographic
analysis
FEBS letters. 277 (1-2), 267-271 (1990)
MEDLINE: 91099514

Hindson,V.J., Moody,P.C., Rowe,A.J. and Shaw,W.V.
Serine acetyltransferase from Escherichia coli is a dimer of
trimers
The Journal of biological chemistry. 275 (1), 461-466 (2000)
MEDLINE: 20085066


Comment:
For other "cys" genes, see HD1030 (cysB), HD1093 (cysS), HD0832 (cysZ), HD0840 (cysQ), HD0896 (cysK).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to serine acetyltransferases; e.g., residues 9-264 are 72% similar to CYSE_HAEIN [1169183], residues 5-271 are 66% similar to CYSE_ECOLI [118135]. and residues 5-271 are 66% similar to CYSE_SALTY [231969].

COGS Summary:  COGS Search
BeTs to 6 clades of COG1045
COG name: Serine acetyltransferase
Functional Class: E
The phylogenetic pattern of COG1045 is ------vcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001451 (Bacterial transferase hexapeptide repeat) with a combined E-value of 8e-15.
    IPB001451    196-231
    IPB001451    190-225


ProDom Summary:  Protein Domain Search
Residues 9-113 are 78% similar to a (SERINE TRANSFERASE ACETYLTRANSFERASE) protein domain (PD005265) which is seen in Q9CL18_PASMU.

Residues 188-233 are 84% similar to a (SERINE TRANSFERASE ACETYLTRANSFERASE) protein domain (PD333364) which is seen in Q9CL18_PASMU.

Residues 114-187 are 83% similar to a (SERINE TRANSFERASE ACETYLTRANSFERASE) protein domain (PD328706) which is seen in CYSE_HAEIN.

Residues 194-233 are 85% similar to a (TRANSFERASE ACETYLTRANSFERASE SERINE) protein domain (PD088539) which is seen in CYSE_ECOLI.



Paralogs:  Local Blast Search
HD0659 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 113 (E-value = 6.4e-59) place HD0659 in the SATase_N family which is described as Serine acetyltransferase, N-terminal (PF06426)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKHIELNQMWQKIRQEAQQLADQEPILASFFHATILTHHNLGSALSYILA
NKLANAIMPAIALKEIIEQAYEADPQIIESAAYDINAVTTRDPAVDRWTT
PLLYLKGFHALQSYRVTHYLWQQGRRDLAVYLQNQISVAFDVDIHPAARL
GHSIMFDHATAIVIGETAVIENDVSILQGVTLGGTGKEHGDRHPKIREGV
MIGAGAKILGNIEIGRYSKIGANSVVLQAVPDHTTAAGIPARIIGRAPQQ
KPAFDMNQYFEEIEGTDGDGI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCACATCGAACTTAATCAAATGTGGCAAAAAATCCGGCAAGAAGC
CCAACAATTAGCCGATCAAGAACCGATATTGGCCAGTTTTTTTCATGCTA
CAATCCTTACTCACCATAATTTGGGTAGCGCGCTTAGCTACATTTTAGCC
AATAAACTAGCTAATGCAATTATGCCCGCTATTGCATTAAAAGAAATTAT
TGAGCAGGCTTATGAAGCAGATCCCCAAATTATTGAAAGTGCCGCTTATG
ATATTAATGCAGTCACAACACGAGATCCCGCCGTAGATAGATGGACAACA
CCACTCCTTTATTTAAAAGGTTTCCACGCCTTACAGAGCTATCGTGTTAC
CCATTATCTTTGGCAACAAGGACGTCGCGATCTTGCAGTTTATCTACAAA
ATCAAATTTCCGTCGCGTTTGATGTCGATATTCACCCTGCCGCACGCTTA
GGGCATAGCATTATGTTTGACCACGCAACTGCCATCGTTATTGGCGAAAC
CGCTGTCATTGAAAATGATGTTTCTATTTTACAAGGCGTAACATTAGGTG
GGACAGGCAAAGAACACGGCGATCGCCACCCCAAAATCCGTGAAGGCGTA
ATGATCGGTGCAGGCGCCAAAATCCTAGGCAATATTGAAATTGGCCGTTA
TTCTAAAATTGGGGCTAACTCAGTAGTCTTACAAGCCGTACCGGATCACA
CTACCGCAGCAGGAATCCCCGCTCGCATTATAGGACGAGCGCCACAACAA
AAACCCGCATTCGATATGAACCAATATTTTGAAGAAATTGAAGGTACAGA
TGGTGATGGCATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy