Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR456 IGR463 IGR459 IGR462 IGR461 IGR457 IGR460 IGR458 HD0654 HD0650 psd,dpsD, - HD0649 mtr,tnaB, - HD0648 rpS12,strA, - HD0655 oapB, - HD0652 rpS7, - HD0656 rfaF,waaF, - HD0653 tufB, - HD0658 oapA, - HD0651 fusA, - HD0657 HD0654 HD0650 psd,dpsD, - HD0649 mtr,tnaB, - HD0648 rpS12,strA, - HD0655 oapB, - HD0652 rpS7, - HD0656 rfaF,waaF, - HD0653 tufB, - HD0658 oapA, - HD0651 fusA, - HD0657 HD0654 HD0650 psd,dpsD, - HD0649 mtr,tnaB, - HD0648 rpS12,strA, - HD0655 oapB, - HD0652 rpS7, - HD0656 rfaF,waaF, - HD0653 tufB, - HD0658 oapA, - HD0651 fusA, - HD0657
* Calculated from Protein Sequence

Gene ID: HD0653

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rfaF  waaF  

Definition:
ADP-heptose--LPS heptosyltransferase II

Gene Start:
516829

Gene Stop:
517734

Gene Length:
906

Molecular Weight*:
33687

pI*:
9.70

Net Charge*:
10.64

EC:
2.4.99.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Primary Evidence:
Bauer,B.A., Lumbley,S.R. and Hansen,E.J.
Characterization of a WaaF (RfaF) homolog expressed by Haemophilus
ducreyi
Infect. Immun. 67 (2), 899-907 (1999)
MEDLINE: 99115572


Secondary Evidence:
Pegues,J.C., Chen,L.S., Gordon,A.W., Ding,L. and Coleman,W.G. Jr.
Cloning, expression, and characterization of the Escherichia coli
K-12 rfaD gene
J. Bacteriol. 172 (8), 4652-4660 (1990)
MEDLINE: 90330578

Chen,L. and Coleman,W.G. Jr.
Cloning and characterization of the Escherichia coli K-12 rfa-2
(rfaC) gene, a gene required for lipopolysaccharide inner core
synthesis
J. Bacteriol. 175 (9), 2534-2540 (1993)
MEDLINE: 93239678


Comment:
For other "rfa" genes, see HD1182 (rfaE) and HD1890 (rfaD).

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported 4322481 in GenBank.

Numerous significant hits in gapped BLAST to ADP-heptose--LPS heptosyltransferase II proteins; e.g., residues 1-300 are 68% similar to RFAF_HAEIN [1172916], residues 1-299 are 58% similar to RFAF_ECOLI [585816], and residues 1-300 are 57% similar to RFAF_SALTY [585817].

COGS Summary:  COGS Search
BeTs to 3 clades of COG0859
COG name: ADP-heptose:LPS heptosyltransferase
Functional Class: M
The phylogenetic pattern of COG0859 is -----Q-cE--HUJ-------
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB002201 (Glycosyltransferase family 9) with a combined E-value of 1.6e-16.
    IPB002201B    202-245


ProDom Summary:  Protein Domain Search
Residues 266-300 are identical to a (TRANSFERASE II HEPTOSYLTRANSFERASE) protein domain (PD393493) which is seen in Q9Z6D3_HAEDU.

Residues 1-107 are identical to a (TRANSFERASE II HEPTOSYLTRANSFERASE) protein domain (PD004673) which is seen in Q9Z6D3_HAEDU.

Residues 169-262 are 58% similar to a (TRANSFERASE HEPTOSYLTRANSFERASE COMPLETE) protein domain (PD002299) which is seen in Q9XCA0_KLEPN.

Residues 108-184 are identical to a (II TRANSFERASE HEPTOSYLTRANSFERASE) protein domain (PD367182) which is seen in Q9Z6D3_HAEDU.



Paralogs:  Local Blast Search
HD0653 is paralogously related to HD0445 (3e-06).


Pfam Summary:  Pfam Search
Residues 22 to 280 (E-value = 2.4e-93) place HD0653 in the Glyco_transf_9 family which is described as Glycosyltransferase family 9 (heptosyltransferase) (PF01075)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPEVHKAITMPIGHGAFRLMERYQIGKSLRNQYDLAIVLPNSFKSAFIPF
FARIAHRRGWKGESRYCLLNDLRTNKNDYPMMVQRYVALAFEATQVPKPD
DLPIAFPYLQTQADEIAQTKAKFAQKLTATENRPLIGFCPGAEFGPAKRW
PHYHYAKLAEILIEKGFAICLFGSKKDQIIAEQIRLGLAEHSQRYCINLA
GQTDLNQAVDLIADCRAIVSNDSGLMHIAAALNKPKPLVALYGPTSPSYT
PPLSKQAVIIRLIDGGLIKIRKGEAKEGYHQSLIDITPDRVVQELNQLLA
C$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAGAAGTGCATAAAGCTATAACGATGCCTATTGGGCATGGGGCTTT
TCGTTTGATGGAACGTTACCAAATAGGTAAATCTTTGCGTAACCAATACG
ACCTAGCCATTGTATTACCAAACTCATTCAAATCTGCGTTTATTCCTTTT
TTTGCAAGGATTGCTCATCGTCGCGGTTGGAAAGGTGAAAGTCGCTACTG
CTTGCTAAATGATCTGCGCACAAATAAAAATGATTATCCTATGATGGTAC
AACGCTATGTAGCGTTAGCCTTTGAAGCAACACAAGTGCCAAAACCAGAC
GATTTACCGATAGCATTCCCATATCTGCAAACACAAGCGGATGAAATAGC
GCAAACAAAAGCAAAATTTGCGCAAAAACTGACCGCTACAGAAAATCGCC
CATTAATAGGCTTTTGTCCAGGCGCAGAATTTGGTCCAGCAAAACGTTGG
CCACATTACCATTATGCAAAATTGGCAGAAATACTGATAGAAAAAGGGTT
TGCAATTTGCCTATTTGGTTCCAAAAAAGATCAAATAATAGCAGAACAAA
TTCGCTTAGGTTTAGCTGAACATTCTCAACGCTATTGCATCAACTTAGCG
GGGCAAACTGATCTTAATCAAGCCGTCGATTTAATTGCCGATTGCCGCGC
GATAGTCAGTAATGACAGTGGATTAATGCACATTGCTGCAGCGTTAAATA
AACCTAAACCGCTTGTTGCTTTATATGGCCCAACAAGCCCATCATATACA
CCCCCCCTGTCTAAACAAGCGGTCATTATTCGCTTGATTGATGGCGGACT
GATAAAAATTCGCAAAGGCGAAGCAAAAGAAGGCTACCATCAAAGTTTAA
TAGATATTACACCGGATCGCGTTGTTCAAGAATTAAACCAACTATTGGCT
TGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy