Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR456 IGR455 IGR459 IGR461 IGR454 IGR457 IGR460 IGR458 HD0654 HD0650 psd,dpsD, - HD0649 mtr,tnaB, - HD0648 rpS12,strA, - HD0655 oapB, - HD0652 rpS7, - HD0656 rfaF,waaF, - HD0653 HD0647 oapA, - HD0651 HD0646 HD0654 HD0650 psd,dpsD, - HD0649 mtr,tnaB, - HD0648 rpS12,strA, - HD0655 oapB, - HD0652 rpS7, - HD0656 rfaF,waaF, - HD0653 HD0647 oapA, - HD0651 HD0646 HD0654 HD0650 psd,dpsD, - HD0649 mtr,tnaB, - HD0648 oapB, - HD0652 rpS7, - HD0656 rfaF,waaF, - HD0653 HD0647 oapA, - HD0651 HD0646 rpS12,strA, - HD0655
* Calculated from Protein Sequence

Gene ID: HD0649

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
psd  dpsD  

Definition:
phosphatidylserine decarboxylase proenzyme

Gene Start:
514058

Gene Stop:
513165

Gene Length:
894

Molecular Weight*:
33639

pI*:
7.20

Net Charge*:
0.51

EC:
4.1.1.65  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism
Glycine, serine and threonine metabolism

Secondary Evidence:
Li,Q.X. and Dowhan,W.
Structural characterization of Escherichia coli phosphatidylserine
decarboxylase
The Journal of biological chemistry. 263 (23), 11516-11522 (1988)
MEDLINE: 88298809

Li,Q.X. and Dowhan,W.
Studies on the mechanism of formation of the pyruvate prosthetic
group of phosphatidylserine decarboxylase from Escherichia coli
The Journal of biological chemistry. 265 (7), 4111-4115 (1990)
MEDLINE: 90154105

Dowhan,W. and Li,Q.X.
Phosphatidylserine decarboxylase from Escherichia coli
Methods in enzymology. 209, 348-359 (1992)
MEDLINE: 92356881


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phosphatidylserine decarboxylase precursors; e.g., residues 10-293 are 66% similar to DPSD_HAEIN [1169420], residues 16-293 are 55% similar to DPSD_ECOLI [118911], and residues 14-293 are 54% similar to the sequence for phosphatidylserine decarboxylase in Vibrio cholerae [9654754].

COGS Summary:  COGS Search
BeTs to 6 clades of COG0688
COG name: Phosphatidylserine decarboxylase
Functional Class:  I
The phylogenetic pattern of COG0688 is amt-Y---ebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003817 (Phosphatidylserine decarboxylase) with a combined E-value of 6.7e-44.
    IPB003817A    70-84
    IPB003817B    95-103
    IPB003817C    147-159
    IPB003817D    169-195
    IPB003817E    253-269


ProDom Summary:  Protein Domain Search
Residues 10-41 are 65% similar to a (DECARBOXYLASE PROTEOME LYASE ZYMOGEN) protein domain (PD089093) which is seen in Q9CJU2_PASMU.

Residues 221-293 are 41% similar to a (PROTEOME COMPLETE DECARBOXYLASE) protein domain (PD273161) which is seen in Q9HUK8_PSEAE.

Residues 49-131 are 32% similar to a (DECARBOXYLASE PHOSPHATIDYLSERINE) protein domain (PD314931) which is seen in Q9HE36_NEUCR.

Residues 43-290 are 68% similar to a (DECARBOXYLASE PHOSPHATIDYLSERINE PROTEOME) protein domain (PD006762) which is seen in DPSD_HAEIN.

Residues 143-219 are 42% similar to a (DECARBOXYLASE PHOSPHATIDYLSERINE) protein domain (PD292651) which is seen in O14333_SCHPO.



Paralogs:  Local Blast Search

HD0649 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 73 to 294 (E-value = 6.1e-90) place HD0649 in the PS_Dcarbxylase family which is described as Phosphatidylserine decarboxylase (PF02666)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSLKSYSTPTYWQRVKVACQYLFPQLPITRLAGWLAEQKWGMVTHFIIRI
FAKQYNVNLAEAEKTNPADYTTFNEFFLRPLKENARPINQDDQAVCLPAD
GKISELGQINENRLLQAKGHYFTLETLLANDEEMAESFKNGSFITTYLSP
RDYHRVHMPCDATLKKMIYVPGDLFSVNSFLAEHIPNLFARNERVICEFE
TAFGPMVQILVGATITASISTVWAGIINPPRSKDVVEYNYQTTGETAIHL
KKGDEMGAFRLGSTVINLFPQATVELVSHLQAGVETRMGERFAKIIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCTAAAATCATATTCAACGCCAACCTATTGGCAACGTGTTAAAGT
AGCTTGCCAATACCTTTTCCCTCAATTACCTATTACTCGCTTAGCTGGTT
GGTTAGCGGAACAAAAATGGGGAATGGTGACACATTTTATAATTCGAATT
TTTGCAAAACAGTATAATGTTAATCTAGCTGAAGCAGAGAAAACCAATCC
AGCCGACTATACCACATTCAATGAGTTTTTTCTTCGTCCATTAAAAGAAA
ATGCACGGCCAATCAATCAAGATGATCAAGCGGTTTGCTTACCTGCAGAC
GGTAAAATCAGTGAGTTAGGCCAGATTAACGAAAATCGTTTATTACAAGC
AAAAGGGCATTATTTCACATTAGAAACATTGTTAGCAAATGATGAAGAAA
TGGCGGAGTCATTTAAAAATGGTAGTTTTATCACAACTTATTTATCACCA
CGTGATTACCATCGTGTTCATATGCCATGTGATGCAACATTGAAAAAGAT
GATTTACGTACCGGGCGATTTATTCTCGGTTAATTCATTTTTAGCTGAAC
ATATCCCGAATTTATTCGCGCGGAATGAACGAGTTATTTGTGAATTTGAA
ACGGCATTTGGTCCTATGGTACAAATCCTAGTCGGAGCAACGATCACAGC
AAGTATTAGCACCGTTTGGGCAGGTATTATTAATCCACCGCGTAGTAAAG
ATGTAGTTGAATATAACTACCAAACCACAGGTGAAACAGCCATTCATTTG
AAAAAAGGCGATGAAATGGGCGCTTTCCGCTTAGGCTCAACCGTAATTAA
TCTATTCCCACAAGCGACCGTTGAACTAGTATCACATTTACAAGCAGGTG
TTGAAACGCGCATGGGTGAACGCTTTGCTAAAATCATTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy