Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR452 IGR451 IGR449 IGR448 IGR446 IGR450 IGR454 IGR447 IGR453 HD0643 HD0641 HD0640 folP, - HD0644 ftsN, - HD0639 rluC, - HD0645 dapE, - HD0642 por,dsbA, - HD0638 HD0647 HD0646 HD0643 HD0641 HD0640 folP, - HD0644 ftsN, - HD0639 rluC, - HD0645 dapE, - HD0642 por,dsbA, - HD0638 HD0647 HD0646 HD0643 HD0641 HD0640 folP, - HD0644 ftsN, - HD0639 rluC, - HD0645 dapE, - HD0642 por,dsbA, - HD0638 HD0647 HD0646
* Calculated from Protein Sequence

Gene ID: HD0644

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
folP  

Definition:
dihydropteroate synthase

Gene Start:
507138

Gene Stop:
506293

Gene Length:
846

Molecular Weight*:
30864

pI*:
6.90

Net Charge*:
-0.50

EC:
2.5.1.15  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Folate biosynthesis

Secondary Evidence:
Swedberg,G., Fermer,C. and Skold,O.
Point mutations in the dihydropteroate synthase gene causing
sulfonamide resistance
Adv. Exp. Med. Biol. 338, 555-558 (1993)
MEDLINE: 94136300

Dallas,W.S., Gowen,J.E., Ray,P.H., Cox,M.J. and Dev,I.K.
Cloning, sequencing, and enhanced expression of the dihydropteroate synthase gene of Escherichia coli MC4100
J. Bacteriol. 174 (18), 5961-5970 (1992)
MEDLINE: 92394900

Achari,A., Somers,D.O., Champness,J.N., Bryant,P.K., Rosemond,J.
and Stammers,D.K.
Crystal structure of the anti-bacterial sulfonamide drug target
dihydropteroate synthase
Nat. Struct. Biol. 4 (6), 490-497 (1997)
MEDLINE: 97331326



Comment:
For other "fol" genes, see HD1108 (folD), HD1118 (folA), HD1465 (folC), HD0978 (folB).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to dihydropteroate synthase (DHPS) proteins; e.g., residues 12-276 are 68% similar to DHPS_HAEIN [1169335], residues 15-276 are 56% similar to DHPS_ECOLI [118603], and residues 12-279 are 55% similar to the sequence for dihydropteroate synthase in Vibrio cholerae [9655073].

COGS Summary:  COGS Search
BeTs to 12 clades of COG0294
COG name: Dihydropteroate synthase
Functional Class:  H
The phylogenetic pattern of COG0294 is amtkyqvCebRHuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000489 (Dihydropteroate synthase) with a combined E-value of 9.2e-63.
    IPB000489A    22-37
    IPB000489B    45-87
    IPB000489C    180-197
    IPB000489D    215-230
    IPB000489E    255-264


ProDom Summary:  Protein Domain Search
Residues 23-276 are 69% similar to a (DIHYDROPTEROATE SYNTHASE FOLATE TRANSFERASE) protein domain (PD001976) which is seen in DHPS_HAEIN.



Paralogs:  Local Blast Search


HD0644 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 25 to 233 (E-value = 2.4e-99) place HD0644 in the Pterin_bind family which is described as Pterin binding enzyme (PF00809)

PDB Hit:
pdb|1AJ0| Crystal Structure Of A Ternary Complex Of E. Coli D... 295 5e-081
pdb|1EYE|A Chain A, 1.7 Angstrom Resolution Crystal Structure O... 164 1e-041
pdb|1AD1|A Chain A, Dihydropteroate Synthetase (Apo Form) From ... 149 3e-037

Gene Protein Sequence:
MQIHFKNYQKKDRLLDLTKPQIMGILNFTPDSFSDSGQFFSLDKALKQVE
KMLNDGANIIDIGGESTRPNAQIISLAEELDRVIPLVEAARKRFDCLISV
DSSKATVFEEAAKAGADILNDIRALTEPQALTTAVKLALPVCLMHMQGNP
QTMQQRPKYDDVLAEVSDFLNQRIFECITSGIAKQHIILDPGFGFGKTVQ
HNYILLKHLKAFADSGFPVLAGLSRKSMIGAVTGKSVEQRTAGSITAALL
AVQHGARIIRVHDVAETADALKVWQAMQDCE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAATCCACTTCAAAAATTATCAAAAAAAAGACCGCTTATTAGACTT
AACTAAGCCACAAATTATGGGCATTTTGAATTTTACGCCCGATTCATTTT
CTGATTCTGGCCAATTCTTCTCTCTTGATAAAGCCCTTAAACAAGTAGAA
AAAATGCTAAATGACGGAGCCAACATTATTGATATCGGCGGAGAATCAAC
CCGCCCCAACGCACAAATTATTAGCCTAGCAGAAGAGCTAGACCGCGTTA
TTCCACTAGTTGAAGCGGCCAGAAAACGTTTTGATTGTTTAATTTCAGTG
GATAGCTCAAAGGCCACCGTATTTGAAGAAGCCGCAAAGGCAGGGGCTGA
TATCTTAAATGATATTCGCGCCTTAACAGAACCACAGGCATTAACAACCG
CAGTCAAACTAGCGTTACCCGTTTGTTTAATGCATATGCAAGGTAATCCA
CAAACTATGCAACAGCGCCCCAAATATGATGATGTGCTAGCAGAAGTCAG
CGATTTTTTAAATCAACGCATTTTTGAATGCATTACATCAGGCATTGCCA
AACAGCATATTATACTTGACCCCGGATTTGGCTTTGGTAAAACTGTTCAA
CACAATTATATTCTGCTAAAACACCTAAAAGCCTTCGCCGATTCAGGCTT
TCCTGTGCTTGCTGGTTTATCGCGTAAATCAATGATCGGCGCCGTAACAG
GCAAAAGCGTTGAACAACGCACAGCAGGATCAATAACCGCAGCATTATTA
GCCGTACAACATGGTGCACGGATTATTCGTGTACACGATGTAGCAGAAAC
AGCAGACGCATTAAAAGTTTGGCAAGCAATGCAAGATTGTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy