Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR452 IGR451 IGR449 IGR448 IGR446 IGR445 IGR444 IGR450 IGR447 IGR453 HD0643 HD0641 HD0640 folP, - HD0644 ftsN, - HD0639 rluC, - HD0645 mob, - HD0636 dapE, - HD0642 HD0637 por,dsbA, - HD0638 HD0646 HD0643 HD0641 HD0640 folP, - HD0644 ftsN, - HD0639 rluC, - HD0645 mob, - HD0636 dapE, - HD0642 HD0637 por,dsbA, - HD0638 HD0646 HD0643 HD0641 HD0640 folP, - HD0644 ftsN, - HD0639 rluC, - HD0645 mob, - HD0636 dapE, - HD0642 HD0637 por,dsbA, - HD0638 HD0646
* Calculated from Protein Sequence

Gene ID: HD0642

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dapE  

Definition:
succinyl-diaminopimelate desuccinylase, dapE

Gene Start:
505847

Gene Stop:
504717

Gene Length:
1131

Molecular Weight*:
41273

pI*:
6.30

Net Charge*:
-5.14

EC:
3.5.1.18  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Lysine biosynthesis

Secondary Evidence:
Bouvier,J., Richaud,C., Higgins,W., Bogler,O. and Stragier,P.
Cloning, characterization, and expression of the dapE gene of
Escherichia coli
J. Bacteriol. 174 (16), 5265-5271 (1992)
Medline: 92355499

Wu,B., Georgopoulos,C. and Ang,D.
The essential Escherichia coli msgB gene, a multicopy suppressor of a temperature-sensitive allele of the heat shock gene grpE, is identical to dapE
J. Bacteriol. 174 (16), 5258-5264 (1992)
Medline: 92355498



Comment:
For other "dap" genes, see HD1107 (dapA), HD1398 (dapB), HD0026 (dapF), HD0630 (dapD).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to succinyl-diaminopimelate desuccinylase protein sequences,e.g. residues 1-375 are 70% similar to succinyl-diaminopimelate desuccinylase in Haemophilus influenzae strain Rd KW20 (1169224|).

Residues 5-375 are 60% similar to succinyldiaminopimelate desuccinylase in Escherichia coli (118244|).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0624
COG name: Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases
Functional Class:  E
The phylogenetic pattern of COG0624 is AM-KYqV-EBRHuj-----nx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001261 (ArgE/dapE/ACY1/CPG2/yscS family) with a combined E-value of 1.6e-09.
    IPB001261A    99-111
    IPB001261B    126-135
    IPB001261C    180-196
***** IPB002933 (Peptidase family M20/M25/M40) with a combined E-value of 6.7e-09.
    IPB002933A    96-100
    IPB002933B    180-196
    IPB002933C    245-258


ProDom Summary:  Protein Domain Search
Residues 238-371 are 70% similar to a (DESUCCINYLASE SUCCINYL-DIAMINOPIMELATE) protein domain (PD225578) which is seen in Q9CM22_PASMU.

Residues 4-112 are 71% similar to a (COMPLETE PROTEOME HYDROLASE DESUCCINYLASE) protein domain (PD001449) which is seen in Q9CM22_PASMU.

Residues 113-237 are 75% similar to a (DESUCCINYLASE SUCCINYL-DIAMINOPIMELATE) protein domain (PD218803) which is seen in Q9CM22_PASMU.

Residues 239-374 are 49% similar to a (PROTEOME COMPLETE PH1288 DESUCCINYLASE) protein domain (PD339119) which is seen in Q9I4H5_PSEAE.



Paralogs:  Local Blast Search

HD0642 is paralogously related to HD0566 (8e-16).


Pfam Summary:  Pfam Search
Residues 9 to 376 (E-value = 2.4e-93) place HD0642 in the Peptidase_M20 family which is described as Peptidase family M20/M25/M40 (PF01546)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VKHNIIELAQQLIRNPSISPQDKGCQQIISQRLAAVGFTLEWMPFGDTLN
LWATHGNGDPCIVFAGHTDIVPTGDPAQWQYPPFSAIIVDEMLHGRGAAD
MKGSLAALVIAAENFVRKYPNHSGKIALLITSDEEATAKDGTAKVVETLM
ARHEKIDYAVIGEPSCSKYLGDIIKNGRRGSITAELYIEGVQGHVAYPHL
AQNPIHTSLAFLNELTTYQWDNGNTFFPPTSLQIANIKAGTGNNNVIPGE
LYLQFNLRYCTEINDQIIKQTVATMLAKYGLQYRIHWHLSGKPFLSSEGK
LVNATIQAVENITKHTPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIHK
VNECVSTEDLAKCGQIYYQILEQLLT$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAACATAATATTATTGAACTTGCCCAACAGCTGATCCGCAATCCATC
GATTAGTCCACAGGATAAAGGCTGCCAACAAATAATTAGCCAACGGCTTG
CCGCGGTAGGATTCACACTCGAATGGATGCCATTTGGTGACACCCTCAAC
CTATGGGCAACACACGGTAATGGTGATCCTTGTATTGTGTTTGCAGGCCA
CACAGATATCGTGCCAACAGGCGATCCGGCACAATGGCAATATCCTCCCT
TCTCCGCCATAATTGTTGATGAAATGTTGCATGGTCGTGGTGCCGCCGAT
ATGAAAGGGTCATTAGCGGCCTTAGTTATTGCTGCAGAAAATTTTGTACG
AAAGTATCCAAATCATTCCGGTAAAATTGCTTTATTAATTACCTCAGATG
AAGAAGCCACTGCCAAAGATGGCACCGCCAAAGTAGTAGAAACCTTAATG
GCACGCCATGAAAAAATAGATTATGCGGTCATTGGTGAACCCTCTTGCAG
CAAATACTTAGGCGATATAATTAAAAACGGACGGCGTGGATCAATCACTG
CGGAGTTATATATTGAAGGTGTTCAAGGGCACGTCGCTTACCCTCATTTA
GCGCAAAATCCGATACATACTTCGCTAGCGTTTTTAAATGAATTGACAAC
CTATCAATGGGATAATGGCAATACTTTCTTTCCGCCTACAAGCTTACAAA
TAGCCAATATTAAAGCAGGCACAGGCAATAATAATGTTATTCCAGGTGAG
CTATACCTACAATTTAACTTACGTTATTGCACGGAAATTAATGATCAAAT
AATCAAACAAACTGTCGCCACAATGTTAGCCAAATATGGATTACAATATC
GCATTCACTGGCATTTATCCGGTAAGCCTTTCTTATCAAGCGAAGGCAAA
TTAGTCAATGCAACCATACAAGCGGTCGAAAACATTACTAAACACACACC
TCGTTTAGATACGAGTGGCGGGACTTCAGATGGGCGCTTTATTGCACTAA
TGGGCGCCGAAGTCGTTGAATTTGGCCCGCTTAATGCGACTATTCATAAA
GTCAATGAATGTGTCAGCACCGAAGACTTGGCAAAATGCGGTCAGATTTA
CTACCAAATTTTAGAACAATTATTAACATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy