Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR451 IGR440 IGR449 IGR448 IGR446 IGR443 IGR439 IGR445 IGR444 IGR450 IGR447 IGR442 IGR441 HD0643 HD0641 HD0640 ftsN, - HD0639 folP, - HD0644 mob, - HD0636 dapE, - HD0642 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 accC, - HD0635 HD0643 HD0641 HD0640 ftsN, - HD0639 folP, - HD0644 mob, - HD0636 dapE, - HD0642 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 accC, - HD0635 HD0643 HD0641 HD0640 ftsN, - HD0639 folP, - HD0644 mob, - HD0636 dapE, - HD0642 HD0637 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 accC, - HD0635 arsC, - HD0631
* Calculated from Protein Sequence

Gene ID: HD0638

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
por  dsbA  

Definition:
periplasmic oxidoreductase (por) (Thiol:disulfide interchange protein dsbA precursor.)

Gene Start:
501610

Gene Stop:
502248

Gene Length:
639

Molecular Weight*:
23719

pI*:
8.10

Net Charge*:
1.62

EC:
5.3.4.1  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table
Biosynthesis and degradation of glycoprotein

Secondary Evidence:
Bardwell,J.C., McGovern,K. and Beckwith,J.
Identification of a protein required for disulfide bond formation
in vivo
Cell. 67 (3), 581-589 (1991)
Medline: 92034980

Kamitani,S., Akiyama,Y. and Ito,K.
Identification and characterization of an Escherichia coli gene
required for the formation of correctly folded alkaline
phosphatase, a periplasmic enzyme
The EMBO journal. 11 (1), 57-62 (1992)
Medline: 92155183

Zhang,H.Z. and Donnenberg,M.S.
DsbA is required for stability of the type IV pilin of
enteropathogenic escherichia coli
Molecular microbiology. 21 (4), 787-797 (1996)
Medline: 97032145

Zapun,A., Bardwell,J.C. and Creighton,T.E.
The reactive and destabilizing disulfide bond of DsbA, a protein
required for protein disulfide bond formation in vivo
Biochemistry. 32 (19), 5083-5092 (1993)
Medline: 93264419

Link,A.J., Robison,K. and Church,G.M.
Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12
Electrophoresis. 18 (8), 1259-1313 (1997)
Medline: 97443975

Grauschopf,U., Winther,J.R., Korber,P., Zander,T., Dallinger,P. and Bardwell,J.C.
Why is DsbA such an oxidizing disulfide catalyst?
Cell. 83 (6), 947-955 (1995)
Medline: 96107333

Akiyama,Y., Kamitani,S., Kusukawa,N. and Ito,K.
In vitro catalysis of oxidative folding of disulfide-bonded
proteins by the Escherichia coli dsbA (ppfA) gene product
The Journal of biological chemistry. 267 (31), 22440-22445 (1992)
Medline: 93054536

Martin,J.L., Bardwell,J.C. and Kuriyan,J.
Crystal structure of the DsbA protein required for disulphide bond
formation in vivo
Nature. 365 (6445), 464-468 (1993)
MEDLINE: 94019776

Guddat,L.W., Bardwell,J.C., Zander,T. and Martin,J.L.
The uncharged surface features surrounding the active site of
Escherichia coli DsbA are conserved and are implicated in peptide
binding
Protein science : a publication of the Protein Society. 6 (6),
1148-1156 (1997)
MEDLINE: 97337435


Comment:
For other "dsb" genes, see HD0807 (dsbD), HD0616 (dsbE), HD1729 (dsbB), HD1340 (dsbC).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to thiol:disulfide interchange protein precursors; e.g., residues 6-212 are 60% similar to DSBA_HAEIN [400828], residues 6-212 are 45% similar to DSBA_ERWCH [1706523], and residues 6-212 are 44% similar to DSBA_SALTY [3122043].

COGS Summary:  COGS Search
BeTs to 3 clades of COG0526
COG name: Thiol-disulfide isomerase and thioredoxins
Functional Class: O,C
The phylogenetic pattern of COG0526 is AMTkYQVCEBRHUJgpoLINX
Number of proteins in this genome belonging to this COG is 7

Blocks Summary:  Blocks Search
***** IPB001853 (DSBA oxidoreductase) with a combined E-value of 9.3e-45.
    IPB001853A    25-37
    IPB001853B    47-61
    IPB001853C    97-117
    IPB001853D    144-182


ProDom Summary:  Protein Domain Search
Residues 25-118 are 71% similar to a (INTERCHANGE CENTER REDOX-ACTIVE PRECURSOR) protein domain (PD352738) which is seen in DSBA_HAEIN.

Residues 130-212 are 53% similar to a (REDOX-ACTIVE CENTER PRECURSOR SIGNAL) protein domain (PD004627) which is seen in DSBA_HAEIN.



Paralogs:  Local Blast Search
HD0638 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 46 to 203 (E-value = 8.4e-40) place HD0638 in the DSBA family which is described as DSBA-like thioredoxin domain (PF01323)

PDB Hit:
pdb|1A23| Solution Nmr Structure Of Reduced Dsba From Escher... 174 1e-044
pdb|1FVJ|A Chain A, The 2.06 Angstrom Structure Of The H32y Mut... 171 5e-044
pdb|1BQ7|A Chain A, Dsba Mutant P151a, Role Of The Cis-Proline ... 171 8e-044

Gene Protein Sequence:
MKKFALKSTLIALSALFSINSTALAADPVEGKEYLQIKQAPSAQKEVIEF
FSFYCPHCYDFELTYKIPAQIKQALPNDVKLVQYHINFLGDQSANLTRAW
SLAMALGVEHTVKKPLFEAVQKDAVKSMEDIKAIFVANGVKVEDFDNGIN
SFAVNALFNKQVKLAEDFKISGVPVFFVNGQYQLNLKGFADSKSNDEFIK
RYVDAVTFLVNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATTTGCATTAAAATCAACATTAATTGCGTTATCTGCATTATT
TAGCATTAATTCGACCGCTTTAGCGGCTGATCCTGTTGAAGGAAAAGAGT
ATTTGCAAATTAAGCAAGCACCTTCAGCACAAAAAGAAGTGATTGAGTTT
TTCTCTTTTTACTGCCCACATTGTTATGATTTTGAATTAACATATAAAAT
TCCAGCACAAATTAAGCAAGCGTTGCCTAACGATGTAAAATTAGTGCAAT
ATCACATTAATTTTTTAGGTGATCAATCTGCTAATTTAACACGAGCTTGG
TCATTAGCAATGGCATTGGGCGTTGAGCATACCGTAAAAAAACCATTATT
TGAGGCTGTGCAAAAAGATGCGGTAAAATCGATGGAAGATATAAAAGCTA
TTTTTGTTGCAAATGGTGTGAAGGTAGAAGATTTTGATAATGGCATTAAT
AGTTTTGCTGTGAATGCGTTATTCAATAAGCAAGTTAAATTAGCGGAAGA
TTTTAAAATTAGTGGTGTTCCGGTCTTTTTTGTGAATGGCCAATATCAAC
TTAATTTGAAAGGGTTTGCTGATTCAAAATCAAATGATGAGTTTATTAAA
CGTTATGTTGATGCTGTAACATTCTTAGTAAACAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy