Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-5S-3 rRNA-23S-3 IGR440 IGR446 IGR443 IGR439 IGR445 IGR444 IGR447 IGR438 IGR442 IGR441 IGR437 HD0640 ftsN, - HD0639 mob, - HD0636 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635 HD0640 ftsN, - HD0639 mob, - HD0636 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635 ftsN, - HD0639 mob, - HD0636 HD0640 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635
* Calculated from Protein Sequence

Gene ID: HD0634

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
accB  

Definition:
biotin carboxyl carrier protein

Gene Start:
498074

Gene Stop:
498532

Gene Length:
459

Molecular Weight*:
16154

pI*:
4.40

Net Charge*:
-8.80

EC:
6.4.1.2  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism

Primary Evidence:
NULL

Secondary Evidence:
Li,S.J. and Cronan,J.E. Jr.
The gene encoding the biotin carboxylase subunit of Escherichia
coli acetyl-CoA carboxylase
The Journal of biological chemistry. 267 (2), 855-863 (1992)
MEDLINE: 92112819

Li,S.J. and Cronan,J.E. Jr.
Growth rate regulation of Escherichia coli acetyl coenzyme A
carboxylase, which catalyzes the first committed step of lipid
biosynthesis
Journal of bacteriology. 175 (2), 332-340 (1993)
MEDLINE: 93123150

Sutton,M.R., Fall,R.R., Nervi,A.M., Alberts,A.W., Vagelos,P.R. and
Bradshaw,R.A.
Amino acid sequence of Escherichia coli biotin carboxyl carrier
protein (9100)
The Journal of biological chemistry. 252 (11), 3934-3940 (1977)
MEDLINE: 77187896

Kondo,H., Shiratsuchi,K., Yoshimoto,T., Masuda,T., Kitazono,A.,
Tsuru,D., Anai,M., Sekiguchi,M. and Tanabe,T.
Acetyl-CoA carboxylase from Escherichia coli: gene organization and nucleotide sequence of the biotin carboxylase subunit
Proceedings of the National Academy of Sciences of the United
States of America. 88 (21), 9730-9733 (1991)
MEDLINE: 92052166

Athappilly,F.K. and Hendrickson,W.A.
Structure of the biotinyl domain of acetyl-coenzyme A carboxylase
determined by MAD phasing
Structure (Camb) 3 (12), 1407-1419 (1995)
MEDLINE: 96363677

Yao,X., Wei,D., Soden,C. Jr., Summers,M.F. and Beckett,D.
Structure of the carboxy-terminal fragment of the apo-biotin
carboxyl carrier subunit of Escherichia coli acetyl-CoA carboxylase
Biochemistry. 36 (49), 15089-15100 (1997)
MEDLINE: 98060761

Roberts,E.L., Shu,N., Howard,M.J., Broadhurst,R.W.,
Chapman-Smith,A., Wallace,J.C., Morris,T., Cronan,J.E. Jr. and
Perham,R.N.
Solution structures of apo and holo biotinyl domains from acetyl
coenzyme A carboxylase of Escherichia coli determined by
triple-resonance nuclear magnetic resonance spectroscopy
Biochemistry. 38 (16), 5045-5053 (1999)
MEDLINE: 99230195


Comment:
For other biotin-related genes, see HD0082, HD0635, HD1007, HD1394, HD1480, HD1680, HD1681.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to biotin carboxyl carrier protein of acetyl-CoA carboxylase; e.g., residues 9-160 are 70% similar to BCCP_HAEIN [1168618], residues 9-160 are 62% similar to the sequence for acetyl-CoA carboxylase, biotin carboxyl carrier protein in Vibrio cholerae [9654707], and residues 9-160 are 60% similar to BCCP_ECOLI [114846].

COGS Summary:  COGS Search
BeTs to 14 clades of COG0511
COG name: Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Functional Class:  I
The phylogenetic pattern of COG0511 is AmtKYQvceBRhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR01071 (Acetyl-CoA biotin carboxyl carrier protein signature) with a combined E-value of 6e-31.
    PR01071A    81-94
    PR01071B    98-112
    PR01071C    113-126
***** IPB001882 (Biotin-requiring enzymes attachment site) with a combined E-value of 6.4e-10.
    IPB001882H    89-134
***** IPB003016 (2-oxo acid dehydrogenases acyltransferase component lipoyl binding site) with a combined E-value of 8.6e-07.
    IPB003016    100-134


ProDom Summary:  Protein Domain Search
Residues 79-152 are 87% similar to a (BIOTIN DIHYDROLIPOAMIDE LIPOYL CARBOXYLASE TRANSFERASE) protein domain (PD000268) which is seen in Q9CLV8_PASMU.



Paralogs:  Local Blast Search

HD0634 is paralogously related to HD0783 (1e-07) and HD1624 (0.001).


Pfam Summary:  Pfam Search
Residues 77 to 151 (E-value = 1.5e-33) place HD0634 in the Biotin_lipoyl family which is described as Biotin-requiring enzyme (PF00364)

PDB Hit:
pdb|3BDO|A Chain A, Solution Structure Of Apo-Biotinyl Domain F... 129 1e-031
pdb|1BDO| Structure Of The Biotinyl Domain Of Acetyl-Coenzym... 128 4e-031
pdb|1A6X| Structure Of The Apo-Biotin Carboxyl Carrier Prote... 127 5e-031

Gene Protein Sequence:
MDIRKIKKLIELVEESGITELEVSEEEGTVRISRAQPVTQAPVQYMAAPQ
AVPASPTVAATPVISPAPVVDAEVSGHAVLSPMVGTFYRSPSPDAKPFVE
VGQTVNVGDALCIVEAMKMMNRIESDKAGVVKAILIGDGEAVEFDQKLII
IE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATATTCGTAAAATCAAAAAACTTATTGAATTAGTGGAAGAATCAGG
TATCACAGAGTTAGAGGTGTCTGAAGAAGAGGGTACTGTACGTATTAGCC
GAGCACAACCTGTAACACAAGCACCAGTACAATATATGGCAGCGCCACAA
GCTGTGCCTGCTTCGCCTACTGTTGCTGCGACACCTGTTATCTCACCTGC
GCCGGTTGTTGATGCTGAAGTAAGTGGCCATGCGGTCCTTTCTCCAATGG
TTGGTACTTTCTATCGTAGCCCAAGTCCAGATGCGAAACCTTTTGTAGAA
GTTGGTCAAACAGTAAATGTTGGAGATGCATTATGTATTGTGGAAGCAAT
GAAAATGATGAACCGTATTGAATCTGATAAAGCCGGGGTTGTTAAAGCGA
TCCTAATCGGAGACGGTGAAGCAGTCGAGTTTGATCAAAAGCTTATTATT
ATTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy