Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-5S-3 rRNA-23S-3 IGR440 IGR443 IGR439 IGR445 IGR444 IGR438 IGR442 IGR441 IGR437 mob, - HD0636 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635 mob, - HD0636 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635 mob, - HD0636 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 por,dsbA, - HD0638 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635
* Calculated from Protein Sequence

Gene ID: HD0631

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
arsC  

Definition:
probable arsenate reductase

Gene Start:
497056

Gene Stop:
497400

Gene Length:
345

Molecular Weight*:
12736

pI*:
6.00

Net Charge*:
-0.86

EC:
1.20.4.1  

Functional Class:
Cellular processes; Detoxification  
Regulatory functions  

Pathway: pathway table

Secondary Evidence:
Diorio,C., Cai,J., Marmor,J., Shinder,R. and DuBow,M.S.
An Escherichia coli chromosomal ars operon homolog is functional in arsenic detoxification and is conserved in gram-negative bacteria
J. Bacteriol. 177 (8), 2050-2056 (1995)
MEDLINE: 95238276


Comment:
0

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to arsenate reductase (arsenical pump modifier proteins); e.g., residues 2-114 are 43% similar to ARSC_ECOLI [584784], residues 2-114 are 42% similar to the sequence for arsC in Klebsiella oxytoca [9622147], and residues 2-114 are 41% similar to to ARSC_YEREN [5915692].

COGS Summary:  COGS Search
BeTs to 3 clades of COG1393
COG name: Arsenate reductase, E.coli type
Functional Class:  P
The phylogenetic pattern of COG1393 is --------EB-H--gp-----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-95 are 43% similar to a (ARSENATE REDUCTASE ARSENICAL) protein domain (PD004262) which is seen in ARSC_ECOLI.



Paralogs:  Local Blast Search

HD0631 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 114 (E-value = 1.1e-30) place HD0631 in the ArsC family which is described as ArsC family (PF03960)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VSLTIYHNPKCSKSRATLAIIREAGIEPTIVEYLNTPLTVAEIKRLLMES
ELSPFDAIRKEVDVYQQYIANQTLTDDEIIELIATYPALLNRPFVSGPKG
AKLCRPPELVKALL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCATTGACTATTTATCATAATCCCAAGTGTAGTAAATCTCGTGCAAC
GTTAGCAATCATTCGCGAAGCGGGCATTGAGCCAACCATTGTTGAATATC
TTAATACACCATTAACAGTGGCAGAAATTAAACGATTATTGATGGAAAGT
GAATTATCTCCATTCGATGCGATTCGTAAAGAGGTTGACGTATATCAGCA
GTATATTGCTAATCAAACGTTGACTGATGATGAGATCATTGAGTTAATTG
CTACTTATCCGGCATTATTAAATCGTCCTTTTGTGAGCGGTCCAAAAGGC
GCAAAACTTTGCCGACCACCAGAACTAGTTAAAGCGTTGCTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy