Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-5S-3 rRNA-23S-3 IGR440 IGR443 IGR439 IGR445 IGR444 IGR438 IGR442 IGR441 IGR437 mob, - HD0636 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635 mob, - HD0636 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635 mob, - HD0636 HD0637 arsC, - HD0631 aroD,aroQ, - HD0632 accB, - HD0634 dapD, - HD0630 pqiA, - HD0629 accC, - HD0635
* Calculated from Protein Sequence

Gene ID: HD0630

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dapD  

Definition:
2,3,4,5-tetrahydropyridine-2-carboxylate

Gene Start:
496187

Gene Stop:
497011

Gene Length:
825

Molecular Weight*:
29663

pI*:
5.60

Net Charge*:
-3.55

EC:
2.3.1.117  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Lysine biosynthesis

Secondary Evidence:
Richaud,C., Richaud,F., Martin,C., Haziza,C. and Patte,J.C.
Regulation of expression and nucleotide sequence of the Escherichia coli dapD gene
J. Biol. Chem. 259 (23), 14824-14828 (1984)
MEDLINE: 85054973


Comment:
For other "dap" genes, see HD1107 (dapA), HD1398 (dapB), HD0026 (dapF), HD0642 (dapE).

Blast Summary:  PSI-Blast Search
Numerous very strong hits in gapped BLAST to 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferases; e.g., residues 1-274 are 90% similar to DAPD_ACTPL [1169221], residues 2-274 are 89% similar to DPAD_HAERIN [1169222], and residues 3-273 are 79% similar to DPAD_ECOLI [2506339]

COGS Summary:  COGS Search
BeTs to 4 clades of COG2171
COG name: Tetrahydrodipicolinate N-succinyltransferase
Functional Class: E
The phylogenetic pattern of COG2171 is ------v-eb-h--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001451 (Bacterial transferase hexapeptide repeat) with a combined E-value of 1.2e-08.
    IPB001451    177-212
    IPB001451    139-174
    IPB001451    183-218
    IPB001451    133-168
    IPB001451    121-156
    IPB001451    171-206
    IPB001451    127-162


ProDom Summary:  Protein Domain Search
Residues 3-100 are 42% similar to a (N-SUCCINYLTRANSFERASE SUCCINYLASE) protein domain (PD414678) which is seen in DAPD_BUCAI.

Residues 101-148 are 97% similar to a (N-SUCCINYLTRANSFERASE) protein domain (PD016271) which is seen in DAPD_HAEIN.

Residues 1-97 are 91% similar to a (N-SUCCINYLTRANSFERASE) protein domain (PD237898) which is seen in DAPD_ACTPL.

Residues 244-273 are identical to a (N-SUCCINYLTRANSFERASE THP SUCCINYLASE) protein domain (PD016268) which is seen in DAPD_ACTPL.

Residues 103-146 are 75% similar to a (TRANSFERASE PROTEOME COMPLETE) protein domain (PD404267) which is seen in TABB_PSESZ.

Residues 149-240 are 64% similar to a (COMPLETE PROTEOME TRANSFERASE ACYLTRANSFERASE LIPID) protein domain (PD000343) which is seen in Q9PH32_XYLFA.



Paralogs:  Local Blast Search
HD0630 is paralogously related to HD1511 (5e-06) and HD1189 (0.001).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|3TDT| Complex Of Tetrahydrodipicolinate N-Succinyltransfe... 434 6e-123
pdb|1TDT|B Chain B, Three-Dimensional Structure Of Tetrahydrodi... 409 1e-115

Gene Protein Sequence:
MSLQAVIEAAFERRAEITPKTVDVETRVAIETVIEKLDSGEYRVAEKIGG
EWVTHQWLKKAVLLSFRINDNQIIDGAETKYYDKVALKFADYTESRFAEE
GFRVVPSATVRKGAYIAKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQ
IGKNVHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIVEEGCV
ISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGSLPSKCGKYSLYCAV
IVKKVDAKTLGKVGINELLRTIEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTACAAGCTGTTATTGAAGCCGCATTTGAACGCCGTGCAGAGAT
TACACCGAAAACTGTTGATGTAGAAACGAGAGTGGCTATTGAAACCGTGA
TTGAAAAATTAGATTCAGGTGAATATCGTGTTGCAGAAAAGATAGGTGGT
GAATGGGTCACGCATCAGTGGTTAAAAAAAGCGGTATTACTTTCGTTTCG
TATTAACGATAATCAAATAATTGATGGTGCTGAAACAAAATATTACGACA
AAGTTGCGTTAAAATTTGCTGATTATACGGAAAGTCGTTTTGCTGAAGAA
GGCTTTCGGGTTGTTCCTTCTGCAACAGTACGTAAGGGGGCATATATTGC
TAAGAACTGTGTATTGATGCCATCTTATGTGAATATTGGTGCTTATGTTG
GTGAAGGTACAATGGTTGATACCTGGGCAACAGTTGGTTCTTGTGCACAA
ATCGGTAAAAATGTTCATTTATCTGGTGGAGTAGGTATTGGTGGTGTATT
GGAGCCTCTCCAAGCTAATCCAACGATTATTGGTGATAATTGCTTTATTG
GTGCACGTTCAGAAGTGGTAGAGGGCGTGATTGTAGAAGAAGGCTGCGTG
ATCTCAATGGGCGTATTTATTGGCCAATCAACGCGCATTTATGATCGTGA
AACCGGTGAAATTCACTATGGTCGAGTGCCTGCGGGATCTGTGGTTGTTT
CGGGTAGTTTGCCATCGAAATGTGGTAAATATAGCCTTTATTGTGCGGTT
ATTGTTAAAAAAGTAGATGCTAAGACTTTAGGGAAAGTGGGCATTAACGA
ATTACTTCGCACGATTGAAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy