Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Glu-1 rRNA-16S-3 rRNA-23S-3 IGR436 IGR435 IGR433 IGR434 IGR437 alr, - HD0624 menF, - HD0621 HD0625 HD0620 recD, - HD0626 priA, - HD0623 alr, - HD0624 menF, - HD0621 HD0625 HD0620 recD, - HD0626 priA, - HD0623 alr, - HD0624 menF, - HD0621 HD0625 HD0620 recD, - HD0626 priA, - HD0623 HD0627 HD0622 HD0627 HD0622
* Calculated from Protein Sequence

Gene ID: HD0624

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
alr  

Definition:
alanine racemase

Gene Start:
486906

Gene Stop:
485782

Gene Length:
1125

Molecular Weight*:
41846

pI*:
7.00

Net Charge*:
0.00

EC:
5.1.1.1  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Alanine and aspartate metabolism
D-Alanine metabolism

Secondary Evidence:
Strych U, Huang HC, Krause KL, Benedik MJ.
Characterization of the alanine racemases from Pseudomonas aeruginosa PAO1.
Curr Microbiol. 2000 Oct;41(4):290-4.
PMID: 10977898

Tauch A, Gotker S, Puhler A, Kalinowski J, Thierbach G.
The alanine racemase gene alr is an alternative to antibiotic resistance genes in cloning systems for industrial Corynebacterium
glutamicum strains.
J Biotechnol. 2002 Oct 9;99(1):79-91.
PMID: 12204559

Patrick WM, Weisner J, Blackburn JM.
Site-directed mutagenesis of Tyr354 in Geobacillus stearothermophilus alanine racemase identifies a role in controlling substrate
specificity and a possible role in the evolution of antibiotic resistance.
Chembiochem. 2002 Aug 2;3(8):789-92. No abstract available.
PMID: 12203980

Strych U, Benedik MJ.
Mutant analysis shows that alanine racemases from Pseudomonas aeruginosa and Escherichia coli are dimeric.
J Bacteriol. 2002 Aug;184(15):4321-5.
PMID: 12107154

Comment:
0

Blast Summary:  PSI-Blast Search
Many strong hits in gapped BLAST to alanine racemases (biosynthetic and catabolic); e.g., residues 1-373 are 55% similar to ALR_HAEIN [1168421], residues 1-373 are 53% similar to ALR1_ECOLI (alanine racemase, biosynthetic) [2506171], and residues 1-369 are 43% similar to the sequence for catabolic alanine racemase dadX in Pseudomonas aeruginosa [5690425]

COGS Summary:  COGS Search
BeTs to 9 clades of COG0787
COG name: Alanine racemase
Functional Class: M
The phylogenetic pattern of COG0787 is -----q-cEBrhuj--ol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000821 (Alanine racemase) with a combined E-value of 7.8e-67.
    IPB000821A    31-41
    IPB000821B    52-79
    IPB000821C    137-149
    IPB000821D    211-237
    IPB000821E    266-296
    IPB000821F    348-373


ProDom Summary:  Protein Domain Search
Residues 78-325 are 53% similar to a (ALANINE PYRIDOXAL RACEMASE ISOMERASE) protein domain (PD401882) which is seen in ALR1_ECOLI.

Residues 8-369 are 57% similar to a (RACEMASE ALANINE ISOMERASE PYRIDOXAL) protein domain (PD003767) which is seen in Q9CNL5_PASMU.

Residues 4-77 are 56% similar to a (ALANINE PYRIDOXAL RACEMASE ISOMERASE) protein domain (PD186147) which is seen in ALR1_SALTY.



Paralogs:  Local Blast Search
HD0624 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 238 (E-value = 2.4e-71) place HD0624 in the Ala_racemase_N family which is described as Alanine racemase, N-terminal domain (PF01168)
Residues 250 to 374 (E-value = 1.8e-65) place HD0624 in the Ala_racemase_C family which is described as Alanine racemase, C-terminal domain (PF00842)

PDB Hit:
pdb|1SFT|A Chain A, Alanine Racemase >gi|3891941|pdb|1BD0|A Cha... 137 3e-033
pdb|2SFP|A Chain A, Alanine Racemase With Bound Propionate Inhi... 134 1e-032

Gene Protein Sequence:
MKPAIATISRQALRHNIQLIKKLAPKQKLLAMIKANAYGQGLLPAAATLA
DLVDGFGVARLHEALEVQETGYTGKILLVEGFFDREELLKTLSRGFDTVI
HCLEQLELLEQVAKEWQIEQQKRFWQRKTKIYFPINIWLKIDTGMHRLGI
HPEQVDLFYARLKSCPLVATISFMSHFSRADELDCGYTEQQIATFEMATE
QYSAHSRSIAASSGILYWPQAHYEWVRPGIIMHGISPHYQPITQLGFKPV
MTLSSTLIAIRSHKAGEPVGYGGAWISDKATTLGVVAMGYGDGYPRNAPE
GTPVLINGRIVPIVGRVSMDMLTVDLGIDSQDQVGDEVILWGNDLLIETV
AQHIGVISYELITKLTPRVIFEYR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACCAGCCATAGCGACTATTAGCCGTCAGGCACTTCGCCATAATAT
TCAATTGATCAAAAAATTAGCGCCTAAGCAAAAACTATTGGCCATGATTA
AAGCAAATGCTTACGGGCAAGGTTTATTACCCGCTGCTGCAACATTAGCT
GATTTAGTCGATGGCTTTGGTGTTGCACGTTTACACGAAGCGCTTGAAGT
GCAAGAAACGGGCTATACTGGCAAAATTTTATTAGTTGAAGGTTTTTTTG
ATCGAGAAGAATTATTAAAAACGCTGTCTCGTGGCTTTGATACCGTTATT
CATTGCCTAGAACAGTTAGAATTATTAGAGCAAGTCGCAAAAGAATGGCA
AATTGAGCAACAGAAAAGATTTTGGCAACGTAAAACTAAAATTTATTTCC
CGATCAATATTTGGCTAAAGATTGATACCGGAATGCATCGTTTAGGCATT
CATCCTGAGCAAGTTGATCTATTTTATGCCCGCTTAAAAAGCTGTCCTTT
GGTTGCCACTATTAGCTTTATGAGCCATTTTAGTCGCGCCGATGAACTGG
ATTGTGGTTATACCGAACAACAGATTGCTACTTTTGAAATGGCAACAGAG
CAATATTCTGCACATTCGCGGAGTATTGCTGCTTCAAGCGGTATTCTTTA
TTGGCCACAAGCGCATTATGAGTGGGTTCGTCCCGGCATTATCATGCATG
GTATCTCGCCTCATTATCAACCAATCACTCAATTAGGCTTTAAGCCTGTG
ATGACGCTTTCTTCTACCTTAATAGCGATCCGCAGCCATAAAGCAGGTGA
ACCGGTTGGCTATGGTGGGGCTTGGATAAGCGATAAAGCCACAACATTAG
GTGTCGTGGCAATGGGCTATGGTGATGGCTACCCTCGAAATGCACCAGAA
GGCACGCCCGTATTAATCAATGGGCGGATCGTGCCAATCGTTGGGCGAGT
ATCAATGGATATGTTGACGGTCGATCTTGGCATAGATAGTCAAGATCAGG
TTGGTGATGAAGTTATTTTATGGGGTAACGATTTATTAATTGAAACAGTT
GCCCAACATATTGGTGTGATCAGCTATGAGTTGATCACTAAACTCACACC
ACGTGTCATTTTTGAATATCGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy