Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR436 IGR435 IGR432 IGR433 IGR434 alr, - HD0624 menF, - HD0621 HD0625 HD0620 nrfG, - HD0619 nrfE, - HD0615 recD, - HD0626 priA, - HD0623 alr, - HD0624 menF, - HD0621 HD0625 HD0620 nrfG, - HD0619 nrfE, - HD0615 recD, - HD0626 priA, - HD0623 alr, - HD0624 menF, - HD0621 HD0620 nrfG, - HD0619 nrfE, - HD0615 recD, - HD0626 priA, - HD0623 HD0622 dsbE, - HD0616 HD0622 dsbE, - HD0616 nrfF, - HD0617 nrfF, - HD0617 HD0625
* Calculated from Protein Sequence

Gene ID: HD0621

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
menF  

Definition:
probable menaquinone-specific isochorismate

Gene Start:
483157

Gene Stop:
481862

Gene Length:
1296

Molecular Weight*:
49028

pI*:
6.50

Net Charge*:
-4.88

EC:
5.4.99.6  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Ubiquinone biosynthesis

Secondary Evidence:
Daruwala,R., Kwon,O., Meganathan,R. and Hudspeth,M.E.
A new isochorismate synthase specifically involved in menaquinone
(vitamin K2) biosynthesis encoded by the menF gene
FEMS Microbiol. Lett. 140 (2-3), 159-163 (1996)
MEDLINE: 96291661


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to menaquinone-specific isochorismate synthases; e.g., residues 12-428 are 41% similat to MENF_HAEIN [1170920], residues 47-431 are 42% similar to MENF_ECOLI [2507503], and residues 34-431 are 38% similar to the sequence for menaquinone-specific isochorismate synthase in Vibrio cholerae [9656516].

COGS Summary:  COGS Search
BeTs to 4 clades of COG1169
COG name: Isochorismate synthase
Functional Class: H,P
The phylogenetic pattern of COG1169 is -------cEBrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 12-153 are 34% similar to a (PROTEOME MENAQUINONE COMPLETE) protein domain (PD127107) which is seen in MENF_HAEIN.

Residues 190-428 are 51% similar to a (SYNTHASE ANTHRANILATE COMPONENT BIOSYNTHESIS LYASE) protein domain (PD000779) which is seen in MENF_HAEIN.



Paralogs:  Local Blast Search
HD0621 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 168 to 429 (E-value = 6.1e-56) place HD0621 in the Chorismate_bind family which is described as chorismate binding enzyme (PF00425)

PDB Hit:
pdb|1QDL|A Chain A, The Crystal Structure Of Anthranilate Synth... 90 6e-019

Gene Protein Sequence:
LLETLTMLIFDQLKQQINNQLGKTTRNLSVIEYQASVDLPPENVALLSWL
KAQHQYPHFFWQARDSDLTLATIGSVKIFSSLEEAQTFVDQTHLALVGGI
QFEGNCHFLLPRLQLVKNNQRLTAYFYLLEQEISEKMAIFTQTFAEFTHL
SQLTLPDNQLLAHQSACDFNHWQHNIEQAISAIQQQQFNKVVLANATTLT
FQHPISPYDLLAASQQTNLGCYHFIWAENATHAFLGSSPERLYQRTGNFF
KTEALAGTAAVTDNLIQTELNAEWLLTDPKNIYENQLVVDDISMNLADCI
TQINIYPAEIKRLHNVQHLRRKIRAKLIEKINDANCLARIHPTAAVAGLP
RIPAKKFIAENENFTRHWYAGTLGYFHTDHAEFTVTLRSAKIDHNQLTLY
AGAGIVAESQADSEWQEIERKSLALARLLKM$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTAGAAACATTAACTATGCTTATTTTTGATCAATTAAAACAACAAAT
TAACAACCAACTCGGTAAAACTACTCGCAATTTAAGTGTGATTGAATATC
AAGCAAGTGTAGATTTGCCACCTGAAAATGTTGCTTTATTAAGCTGGTTA
AAAGCTCAACACCAATATCCGCATTTCTTTTGGCAAGCACGCGATTCTGA
TCTCACATTAGCTACTATCGGCTCAGTCAAAATATTCTCTTCATTAGAAG
AAGCACAAACATTTGTTGATCAAACGCATTTGGCACTTGTCGGTGGAATT
CAATTTGAAGGCAATTGCCACTTTCTATTGCCTCGCCTGCAATTAGTCAA
AAATAATCAGCGATTAACCGCTTATTTCTATCTTCTTGAACAAGAAATCA
GTGAGAAAATGGCCATATTCACCCAAACATTTGCTGAATTTACGCATTTA
TCGCAGTTAACATTACCAGATAATCAACTACTTGCACATCAATCAGCATG
TGATTTTAACCATTGGCAACACAATATTGAACAAGCAATCTCGGCTATTC
AACAACAACAGTTTAATAAAGTTGTACTTGCTAATGCGACAACACTCACG
TTCCAACACCCCATTTCCCCCTATGATTTATTAGCCGCAAGCCAACAAAC
AAACTTAGGTTGCTACCATTTTATTTGGGCAGAAAACGCGACTCACGCTT
TCTTAGGTTCTAGCCCTGAACGGCTTTATCAAAGAACAGGCAACTTTTTT
AAAACAGAAGCATTAGCAGGAACGGCTGCAGTCACTGATAATCTTATTCA
AACAGAATTAAATGCCGAGTGGTTACTCACTGATCCTAAAAACATCTATG
AAAATCAGTTAGTGGTTGATGATATTTCAATGAATTTAGCCGACTGTATT
ACACAGATTAACATTTATCCTGCTGAAATTAAGCGCTTACATAATGTACA
ACACTTACGCCGTAAAATTCGTGCTAAATTAATCGAAAAAATTAATGATG
CTAATTGTTTAGCTAGAATTCATCCCACAGCAGCAGTAGCAGGGTTGCCT
AGAATTCCAGCAAAAAAATTTATTGCGGAAAATGAAAATTTCACTCGCCA
TTGGTACGCAGGCACTTTAGGTTATTTTCATACCGATCACGCTGAATTTA
CTGTCACGTTGCGTTCTGCCAAGATTGACCATAATCAACTCACACTTTAT
GCTGGTGCTGGCATTGTTGCAGAATCACAAGCTGATTCAGAATGGCAGGA
AATAGAACGCAAGTCTTTAGCATTAGCCAGACTCCTTAAAATGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy