Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR425 IGR426 IGR431 IGR430 IGR427 IGR428 IGR429 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 rnt, - HD0611 kefC,kefBC, - HD0614 nrfE, - HD0615 cyaA, - HD0613 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 rnt, - HD0611 kefC,kefBC, - HD0614 nrfE, - HD0615 cyaA, - HD0613 fabB, - HD0612 HD0608 HD0607 HD0609 HD0608 gloA, - HD0610 rnt, - HD0611 kefC,kefBC, - HD0614 nrfE, - HD0615 cyaA, - HD0613
* Calculated from Protein Sequence

Gene ID: HD0613

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cyaA  

Definition:
adenylate cyclase

Gene Start:
472800

Gene Stop:
475313

Gene Length:
2514

Molecular Weight*:
96909

pI*:
7.40

Net Charge*:
3.65

EC:
4.6.1.1  

Functional Class:
Regulatory functions  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Kimura Y, Mishima Y, Nakano H, Takegawa K.
An adenylyl cyclase, CyaA, of Myxococcus xanthus functions in signal transduction during osmotic stress.
J Bacteriol. 2002 Jul;184(13):3578-85.
PMID: 12057952

Lawrence AJ, Coote JG, Kazi YF, Lawrence PD, MacDonald-Fyall J, Orr BM, Parton R, Riehle M, Sinclair J, Young J, Price NC.
A direct pyrophosphatase-coupled assay provides new insights into the activation of the secreted adenylate cyclase from Bordetella pertussis by calmodulin.
J Biol Chem. 2002 Jun 21;277(25):22289-96.
PMID: 11934879

Dorocicz,I.R., Williams,P.M. and Redfield,R.J.
The Haemophilus influenzae adenylate cyclase gene: cloning, sequence, and essential role in competence
J. Bacteriol. 175 (22), 7142-7149 (1993)
MEDLINE: 94042886

Mock,M., Crasnier,M., Duflot,E., Dumay,V. and Danchin,A.
Structural and functional relationships between Pasteurella multocida and enterobacterial adenylate cyclases
J. Bacteriol. 173 (19), 6265-6269 (1991)
MEDLINE: 92011391


Comment:
For the cyaY gene, see HD0473.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to adenylate cyclase proteins; e.g., residues 33-827 are 47% similar to CYAA_PASMU [544119], residues 27-828 are 46% similar to CYAA_HAEIN [729246], and residues 35-826 are 40% similar to the sequence for adenylate cyclase in Yersinia intermedia [1542956].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB000274 (Adenylate cyclases class-I) with a combined E-value of 1.7e-223.
    IPB000274A    35-89
    IPB000274B    116-163
    IPB000274E    244-289
    IPB000274F    313-354
    IPB000274G    358-411
    IPB000274H    412-445
    IPB000274I    446-480
    IPB000274J    481-521
    IPB000274K    549-597
    IPB000274L    606-639
    IPB000274M    640-676
    IPB000274N    680-720
    IPB000274O    735-752
    IPB000274P    759-797
    IPB000274D    215-250


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0613 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VKELVLANISYSQTAIDVSSYFITIFEKKLTWAMQRVDALNDFRIERALA
ANNPQFQHVFSLLPLLLHTNCPELPVYVKNAPSGIAQFELSAYQQAYLAN
LMVSDDVVEAFSSHSAFDALYSMGSTGSITQTSLSDLDLWLCYSDRLTAV
EYQLIEQKLNKIKQWSQQFGVEINFYLMNPSHFKAHLDHKDVNEEHSGST
QHFFLLDEFYRSAIRLAGKRLLWQHLSDEDYQVCVAQGAFKSKEWIDFGD
FSSLSTAEFFGASLWQLYKGIACPYKSAIKILLLESYSQTYPATDLISKE
FKRKLLSQQRCSYHFDPYLAMLERVTAYLNGQQERIRLAFLRMCFYIKAM
EGEYIESWRTAALDELVAEWKWEDEYLQLIQHRHTWKIKQAVKHQQMIVD
QLLHSYRNLIHFARKFHIDPSIMTSDIDTLMRKLYSVFEVLPGKVPLINP
NIAQNLAESALTFIEVQGNSAIQPGWYLINQAPKSPYNSALRYVRNGKSL
IKIVAWSYFNGLITSSTQLHLISPSLDLNKLRQFITDLRLSFPVQAPAIN
EQDMLHPNEIRSLILAVNLVKDPTQKLEARRTAVQPSDLFNFGSCQESLV
GSVSIIYRNMWNEIRTQHFEGNDAILKALKLISNKIYRSSAPPQSVNVFC
YSRRLRSELRDFIADLAHKCITIQTGTISQKQPLNTLKVAGKIWQFVFGK
KTVYIQPLTQQAVDLLENNANKYVLKQTKPQLGFPKEIDEFASEGFLQFF
FEDNLDNSFNVYILDERNRLETYYNCFDAKEEKIREINRLYSEQKTNILA
VASFNFPQFYQIINVSDEIKIVPFQSKQHRDYLLQQQ$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAAGAGTTGGTGTTAGCAAATATTAGCTATTCTCAAACAGCAATTGA
TGTTTCAAGCTATTTTATAACTATTTTTGAGAAAAAATTAACCTGGGCAA
TGCAACGTGTTGATGCGTTAAACGATTTTAGAATTGAACGAGCCTTAGCG
GCGAATAATCCACAATTTCAGCATGTTTTTTCCTTATTACCACTTCTTCT
TCATACAAATTGTCCTGAATTACCGGTCTATGTAAAAAATGCACCAAGTG
GTATTGCACAATTTGAGTTATCTGCTTATCAACAAGCGTATTTAGCTAAT
TTAATGGTATCTGATGATGTAGTAGAAGCATTTTCTAGCCATTCAGCCTT
TGATGCACTTTATTCTATGGGAAGTACGGGCTCTATTACCCAAACAAGTT
TATCGGATTTAGATCTTTGGCTGTGTTATTCCGATCGCTTAACAGCGGTC
GAGTATCAATTAATTGAGCAAAAACTAAATAAGATTAAACAGTGGTCGCA
ACAGTTTGGCGTTGAGATTAATTTTTACTTAATGAATCCAAGCCATTTTA
AAGCCCATTTAGATCATAAAGATGTGAATGAAGAGCATAGTGGATCTACA
CAGCACTTTTTCTTATTAGATGAATTCTATCGTTCGGCAATCCGTTTGGC
AGGCAAACGACTATTATGGCAACACTTATCAGATGAAGATTATCAGGTTT
GTGTTGCGCAAGGCGCGTTTAAATCAAAAGAATGGATTGATTTTGGCGAT
TTTTCCTCACTTTCGACCGCTGAATTTTTTGGCGCGAGTTTATGGCAATT
GTATAAAGGCATTGCGTGTCCATATAAATCGGCAATTAAAATTTTATTGT
TAGAAAGTTATTCTCAAACTTATCCCGCTACTGATCTAATTTCCAAAGAA
TTTAAACGAAAATTATTAAGCCAACAGCGTTGTTCTTATCATTTTGATCC
TTATTTAGCAATGTTAGAACGCGTTACTGCGTATTTAAATGGTCAGCAAG
AACGGATACGGTTAGCTTTTTTGCGTATGTGCTTTTATATTAAAGCGATG
GAAGGTGAATATATTGAGAGTTGGCGTACGGCAGCATTAGATGAATTAGT
CGCCGAATGGAAGTGGGAAGATGAATATCTTCAACTTATACAACATCGCC
ATACTTGGAAAATAAAACAAGCCGTTAAACATCAGCAAATGATTGTTGAT
CAATTGCTACACAGTTATCGTAACCTTATTCATTTTGCCCGCAAATTTCA
TATTGATCCTAGTATTATGACAAGTGATATTGATACTTTGATGCGTAAAT
TATATTCTGTGTTCGAAGTGTTGCCGGGTAAAGTGCCGTTGATTAATCCT
AATATTGCTCAAAATTTAGCAGAAAGTGCACTTACATTCATTGAAGTGCA
AGGTAATTCAGCTATTCAACCGGGTTGGTATTTAATTAATCAAGCGCCTA
AGAGCCCATATAATTCAGCTTTACGTTATGTCAGAAATGGCAAAAGCTTA
ATTAAAATTGTAGCTTGGAGTTATTTTAATGGTTTAATTACTTCAAGTAC
GCAATTGCATTTAATTAGCCCTAGTCTAGATTTAAACAAATTACGCCAAT
TTATTACTGATTTACGGCTTTCTTTTCCTGTACAAGCGCCTGCCATTAAT
GAACAAGATATGTTACACCCTAATGAAATTCGTAGTTTAATTTTAGCGGT
CAATTTAGTAAAAGATCCTACGCAAAAGTTAGAAGCTCGGCGTACAGCGG
TGCAACCTAGTGATTTGTTTAACTTTGGATCTTGCCAAGAAAGTTTAGTG
GGGAGTGTCAGTATTATTTATCGTAATATGTGGAATGAAATCCGCACTCA
GCATTTTGAAGGTAATGATGCGATTTTAAAAGCGTTAAAGTTAATTTCAA
ATAAAATATATCGTAGTTCTGCGCCACCACAATCGGTGAATGTATTTTGT
TATAGTCGCCGTTTACGTAGTGAATTGCGCGATTTTATTGCTGATCTCGC
GCATAAATGTATTACTATTCAAACGGGAACTATTTCACAAAAACAACCGC
TTAATACATTAAAAGTAGCCGGTAAAATATGGCAGTTTGTATTTGGCAAA
AAAACGGTATATATTCAACCACTCACTCAACAAGCGGTGGATTTATTAGA
AAATAATGCAAATAAGTATGTTTTAAAACAAACGAAACCACAATTAGGTT
TTCCGAAAGAAATAGATGAATTTGCTAGTGAGGGCTTTTTACAATTTTTC
TTTGAAGATAATTTAGATAATAGTTTTAATGTGTATATCTTAGATGAACG
AAATAGATTAGAAACTTATTATAATTGTTTTGATGCTAAAGAGGAAAAAA
TAAGAGAAATCAATCGCTTGTATTCAGAACAAAAAACAAACATATTAGCA
GTGGCAAGTTTTAACTTTCCACAATTTTATCAAATTATCAATGTATCTGA
TGAAATAAAAATTGTGCCATTTCAAAGTAAGCAACATCGTGATTATTTAT
TACAACAGCAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy