Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR425 IGR426 IGR430 IGR427 IGR428 IGR429 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 rnt, - HD0611 kefC,kefBC, - HD0614 cyaA, - HD0613 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 rnt, - HD0611 kefC,kefBC, - HD0614 cyaA, - HD0613 fabB, - HD0612 HD0607 HD0608 HD0609 HD0608 gloA, - HD0610 rnt, - HD0611 kefC,kefBC, - HD0614 cyaA, - HD0613
* Calculated from Protein Sequence

Gene ID: HD0612

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
fabB  

Definition:
3-oxoacyl-[acyl-carrier-protein] synthase I

Gene Start:
472536

Gene Stop:
471319

Gene Length:
1218

Molecular Weight*:
42434

pI*:
5.40

Net Charge*:
-8.38

EC:
2.3.1.41  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Secondary Evidence:
Olsen,J.G., Kadziola,A., von Wettstein-Knowles,P.,
Siggaard-Andersen,M., Lindquist,Y. and Larsen,S.
The X-ray crystal structure of beta-ketoacyl [acyl carrier protein] synthase I
FEBS Lett. 460 (1), 46-52 (1999)
MEDLINE: 20035836


Jackowski S, Zhang YM, Price AC, White SW, Rock CO.
A missense mutation in the fabB (beta-ketoacyl-acyl carrier protein synthase I) gene confers tiolactomycin resistance to Escherichia coli.
Antimicrob Agents Chemother. 2002 May;46(5):1246-52.
PMID: 11959552




Comment:
For other "fab" genes, see HD1188 (fabZ), HD1266 (fabI), HD0707 (fabD)



Blast Summary:  PSI-Blast Search
Many very strong hits in gapped BLAST to 3-oxoacyl-[acyl-carrier-protein] synthases; e.g., residues 1-405 are 80% similar to FABB_HAEIN [1169589], residues 1-404 are 68% similar to FABB_ECOLI [119783], and residues 1-405 are 61% similar to the sequence for beta-ketoacyl-ACP synthase I in Pseudomonas aeruginosa [2384564].

COGS Summary:  COGS Search
BeTs to 10 clades of COG0304
COG name: 3-oxoacyl-(acyl-carrier-protein) synthase I
Functional Class:  I
The phylogenetic pattern of COG0304 is ----YqvCEBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000794 (Beta-ketoacyl synthase) with a combined E-value of 1.1e-13.
    IPB000794B    217-229
    IPB000794C    327-336


ProDom Summary:  Protein Domain Search
Residues 1-67 are 83% similar to a (I SYNTHASE TRANSFERASE PROTEOME) protein domain (PD389521) which is seen in Q9CNT6_PASMU.

Residues 324-402 are 46% similar to a (SYNTHASE PROTEOME II BETA-KETOACYL-ACP) protein domain (PD063696) which is seen in Q9PCW5_XYLFA.

Residues 214-284 are 45% similar to a (SYNTHASE POLYKETIDE CHAIN LENGTH) protein domain (PD063697) which is seen in Q9ZCH8_RICPR.

Residues 276-313 are 84% similar to a (SYNTHASE I II COMPLETE) protein domain (PD413621) which is seen in Q9CNT6_PASMU.

Residues 365-404 are 75% similar to a (I SYNTHASE TRANSFERASE BETA-) protein domain (PD373795) which is seen in FABB_ECOLI.

Residues 68-148 are 82% similar to a (I SYNTHASE BIOSYNTHESIS) protein domain (PD019789) which is seen in Q9CNT6_PASMU.

Residues 153-399 are 23% similar to a (NONJ NONK) protein domain (PD360282) which is seen in Q9XDF8_BBBBB.

Residues 218-275 are 70% similar to a (SYNTHASE TRANSFERASE PHOSPHOPANTETHEINE) protein domain (PD000224) which is seen in FABB_HAEIN.

Residues 68-131 are 45% similar to a (SYNTHASE TRANSFERASE II COMPLETE PROTEOME) protein domain (PD001987) which is seen in O33878_PSEAE.

Residues 315-364 are 90% similar to a (SYNTHASE TRANSFERASE PHOSPHOPANTETHEINE) protein domain (PD000208) which is seen in Q9CNT6_PASMU.

Residues 152-229 are 78% similar to a (TRANSFERASE SYNTHASE PHOSPHOPANTETHEINE POLYKETIDE) protein domain (PD000145) which is seen in Q9I3B2_PSEAE.



Paralogs:  Local Blast Search
HD0612 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 245 (E-value = 3.3e-64) place HD0612 in the ketoacyl-synt family which is described as Beta-ketoacyl synthase, N-terminal domain (PF00109)
Residues 253 to 404 (E-value = 2.5e-58) place HD0612 in the Ketoacyl-synt_C family which is described as Beta-ketoacyl synthase, C-terminal domain (PF02801)

PDB Hit:
pdb|1DD8|A Chain A, Crystal Structure Of Beta-Ketoacyl-[acyl Ca... 541 5e-155
pdb|1FJ4|A Chain A, The Structure Of Beta-Ketoacyl-[acyl Carrie... 540 2e-154
pdb|1KAS| Beta-Ketoacyl-Acp Synthase Ii From Escherichia Col... 258 7e-070

Gene Protein Sequence:
MKRVVITGLGIISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQIAG
TVKLNPAELIDRKIYRFMGDAAAYAYLAMKEAIEDSALTETQVSNDRTGL
VIGAGTGSAHSQLVACDAVRGPRGIKAVGPYAVTKTMASSVSACLATPYK
IRGVNYSISSACATSAHCIGHAMELIQLGKQDIVFAGGAEELSWECATEF
DAMGAVSTKYNDTPTKASRAYDANRDGFVIAGGGAVVVVEELEHALARGA
KIYAEIVGYGATSDGYDMVAPSGEGAERCMRQALATVNGEIEYINVHGTS
TPVGDVKELAAIKNVFADKKPAISSTKSMTGHSLGAAGAHEAIYSLLMLD
NNFIAPSINITTLDEQAEGLNIVTECQHTPLTTVMSNSFGFGGTNAALVF
QKYKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGAGTCGTTATCACTGGTTTAGGTATTATTTCTAGTATCGGTAA
CAATAAAGAAGAAGTTTTAGCCTCATTAAAAGAAGGCAAATCAGGCATTG
AATTTGTGCCAGAATTTGCCGAAGTAGGTATGCGTAGCCAAATTGCAGGC
ACTGTTAAATTAAATCCAGCTGAATTAATCGATCGTAAAATCTATCGTTT
TATGGGAGATGCGGCGGCTTATGCTTATCTTGCAATGAAAGAAGCCATTG
AAGATTCAGCCTTAACAGAAACACAAGTTTCAAATGATCGCACCGGTTTA
GTCATCGGAGCGGGAACCGGTTCTGCACATAGCCAACTAGTTGCTTGTGA
TGCTGTTCGTGGCCCACGTGGTATTAAAGCGGTTGGGCCATACGCAGTGA
CCAAAACCATGGCATCTAGCGTTTCTGCCTGCCTAGCGACCCCATACAAA
ATTCGAGGGGTTAACTATTCTATCAGCTCGGCTTGTGCAACCTCAGCACA
CTGTATTGGCCACGCAATGGAATTAATCCAACTCGGCAAACAAGATATTG
TTTTTGCGGGTGGTGCTGAAGAACTGTCGTGGGAGTGTGCAACAGAATTT
GATGCAATGGGCGCCGTATCTACTAAATATAATGATACACCGACTAAAGC
TTCACGTGCTTACGATGCAAATCGTGATGGTTTTGTTATCGCAGGCGGTG
GCGCGGTAGTGGTTGTAGAAGAATTAGAACACGCGTTAGCACGTGGTGCT
AAAATTTATGCAGAAATTGTAGGCTATGGTGCAACTTCTGATGGTTATGA
TATGGTTGCGCCAAGTGGTGAGGGTGCTGAACGTTGTATGCGTCAGGCAT
TAGCAACGGTTAATGGCGAAATTGAATATATTAATGTACATGGTACATCA
ACGCCTGTTGGCGATGTAAAAGAATTAGCCGCGATTAAAAATGTCTTTGC
CGATAAAAAACCTGCCATTTCATCAACCAAATCAATGACTGGTCATTCAT
TAGGTGCCGCAGGTGCGCACGAAGCAATTTATTCATTACTGATGTTAGAC
AATAATTTTATTGCACCAAGCATTAATATTACCACACTAGATGAACAAGC
AGAAGGCTTAAATATTGTTACAGAATGCCAACATACGCCACTAACTACAG
TTATGTCGAATAGCTTTGGTTTTGGTGGCACAAACGCAGCATTAGTTTTC
CAAAAATATAAAGGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy