Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR424 IGR425 IGR426 IGR430 IGR427 IGR428 IGR429 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 folK, - HD0605 rnt, - HD0611 kefC,kefBC, - HD0614 cyaA, - HD0613 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 folK, - HD0605 rnt, - HD0611 kefC,kefBC, - HD0614 cyaA, - HD0613 fabB, - HD0612 HD0607 HD0608 HD0606 HD0606 HD0609 HD0608 gloA, - HD0610 folK, - HD0605 rnt, - HD0611 kefC,kefBC, - HD0614 cyaA, - HD0613
* Calculated from Protein Sequence

Gene ID: HD0611

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rnt  

Definition:
ribonuclease T (Exoribonuclease T) (RNase T)

Gene Start:
470478

Gene Stop:
471122

Gene Length:
645

Molecular Weight*:
23764

pI*:
7.90

Net Charge*:
2.73

EC:
3.1.13.-  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Secondary Evidence:
Huang,S. and Deutscher,M.P.
Sequence and transcriptional analysis of the Escherichia coli rnt
gene encoding RNase T
J. Biol. Chem. 267 (35), 25609-25613 (1992)
MEDLINE: 93094287

Padmanabha,K.P. and Deutscher,M.P.
RNase T affects Escherichia coli growth and recovery from metabolic stress
J. Bacteriol. 173 (4), 1376-1381 (1991)
MEDLINE: 91139578


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ribonuclease T proteins; e.g., residues 2-212 are 82% similar to RNT_PASHA [8134659], residues 2-209 are 74% similar to RNT_HAEIN [1173107], and residues 14-210 are 64% similar to RNT_ECOLI [266952].

COGS Summary:  COGS Search
BeTs to 7 clades of COG0847
COG name: DNA polymerase III epsilon subunit (3'-5' exonuclease)
Functional Class: L
The phylogenetic pattern of COG0847 is a---YQvcEbRHuj---lINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 11-117 are 85% similar to a (RIBONUCLEASE RNASE 3.1.13.- EXONUCLEASE) protein domain (PD157099) which is seen in RNT_PASHA.

Residues 129-200 are 86% similar to a (RIBONUCLEASE RNASE EXONUCLEASE 3.1.13.-) protein domain (PD384566) which is seen in RNT_PASHA.



Paralogs:  Local Blast Search


HD0611 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 20 to 195 (E-value = 1.4e-35) place HD0611 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MTEQVTDHNLLKHRFRGYLPVIIDVETAGLNAKTDALLELAAITVKMDQQ
GYLVPDQKCHFHIQPFENANINADSLKFNGIDIHNPLRGAVAEAIAIPEM
FKMVRRAIKEQGCQRAVIVAHNATFDQAFLQAAVKRINAKRDPFHPFAMF
DTASLAGLMYGQTVLVKACQIANIAFDGKQAHSALYDTEKTTELFCAMVN
RLKDLGGFPLLNPK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGAACAAGTAACAGATCATAATTTATTAAAACATCGTTTTCGTGG
CTATTTGCCTGTGATTATTGATGTTGAAACAGCAGGATTAAATGCAAAAA
CAGATGCATTATTAGAGCTTGCAGCAATCACCGTTAAAATGGATCAGCAA
GGATATCTAGTTCCCGATCAAAAGTGCCATTTTCATATTCAACCCTTTGA
AAATGCCAATATTAATGCGGACTCACTGAAATTTAATGGTATTGATATTC
ATAATCCTTTACGAGGTGCGGTGGCAGAAGCGATTGCTATTCCCGAAATG
TTTAAAATGGTACGGCGTGCTATTAAAGAGCAAGGTTGCCAACGAGCGGT
GATTGTCGCACATAACGCCACCTTTGATCAGGCGTTTTTACAAGCCGCAG
TCAAGCGGATTAATGCCAAGCGTGATCCGTTTCACCCCTTTGCTATGTTT
GATACCGCTTCTTTAGCCGGTTTAATGTATGGGCAAACAGTCTTGGTCAA
GGCTTGTCAAATTGCTAATATTGCATTTGATGGTAAACAGGCACATTCAG
CATTATATGATACGGAAAAAACTACCGAGTTATTTTGTGCAATGGTAAAT
CGACTGAAAGATTTAGGTGGTTTTCCATTGCTGAATCCTAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy