Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR424 IGR425 IGR423 IGR426 IGR427 IGR428 IGR429 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 folK, - HD0605 rnt, - HD0611 pcnB, - HD0604 cyaA, - HD0613 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 folK, - HD0605 rnt, - HD0611 pcnB, - HD0604 cyaA, - HD0613 fabB, - HD0612 HD0607 HD0608 HD0606 HD0606 HD0609 HD0608 gloA, - HD0610 folK, - HD0605 rnt, - HD0611 pcnB, - HD0604 cyaA, - HD0613
* Calculated from Protein Sequence

Gene ID: HD0610

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gloA  

Definition:
lactoylglutathione lyase

Gene Start:
469915

Gene Stop:
470322

Gene Length:
408

Molecular Weight*:
15057

pI*:
5.00

Net Charge*:
-4.28

EC:
4.4.1.5  

Functional Class:
Cellular processes; Detoxification  

Pathway: pathway table
Pyruvate metabolism

Secondary Evidence:
Clugston,S.L., Daub,E., Kinach,R., Miedema,D., Barnard,J.F. and
Honek,J.F.
Isolation and sequencing of a gene coding for glyoxalase I activity from Salmonella typhimurium and comparison with other glyoxalase I sequences
Gene. 186 (1), 103-111 (1997)
MEDLINE: 97199376

Clugston,S.L., Barnard,J.F., Kinach,R., Miedema,D., Ruman,R.,
Daub,E. and Honek,J.F.
Overproduction and characterization of a dimeric non-zinc
glyoxalase I from Escherichia coli: evidence for optimal activation by nickel ions
Biochemistry. 37 (24), 8754-8763 (1998)
MEDLINE: 98292407

He,M.M., Clugston,S.L., Honek,J.F. and Matthews,B.W.
Determination of the structure of Escherichia coli glyoxalase I
suggests a structural basis for differential metal activation
Biochemistry. 39 (30), 8719-8727 (2000)
MEDLINE: 20374551


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to lactoylglutathione lyase (glyoxylase I) proteins; e.g., residues 1-135 are 71% similar to LGUL_HAEIN [1175222], residues 1-135 are 69% similar to LGUL_ECOLI [2494845], and residues 1-135 are 68% similar to LGUL_SALTY [2494846].

COGS Summary:  COGS Search
BeTs to 8 clades of COG0346
COG name: Lactoylglutathione lyase
Functional Class: E
The phylogenetic pattern of COG0346 is A-tky--CEBRh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000325 (Glyoxalase I) with a combined E-value of 1.4e-49.
    IPB000325A    5-43
    IPB000325B    55-64
    IPB000325C    70-104
    IPB000325D    110-122
***** IPB000486 (Extradiol ring-cleavage dioxygenase) with a combined E-value of 2.6e-06.
    IPB000486C    102-126


ProDom Summary:  Protein Domain Search
Residues 9-126 are 76% similar to a (LYASE I GLYOXALASE LACTOYLGLUTATHIONE) protein domain (PD002334) which is seen in Q9CM55_PASMU.



Paralogs:  Local Blast Search

HD0610 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 123 (E-value = 9.2e-40) place HD0610 in the Glyoxalase family which is described as Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903)

PDB Hit:
pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyox... 198 2e-052
pdb|1QIP|B Chain B, Human Glyoxalase I Complexed With S-P- Nitr... 83 2e-017
pdb|1BH5|B Chain B, Human Glyoxalase I Q33e, E172q Double Mutan... 82 4e-017

Gene Protein Sequence:
MRILHTMLRVGNLERSIKFYTEVLGMRLLRTSENEQYKYSLAFLGYADES
ENAVLELTYNWGVDHYDLGNAFGHIALGIDNIYTTVEAVRLAGGKITREP
GPVLGGKTVIAFAEDPDGYKIEFIENKNAQVALGN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAATTTTGCATACTATGTTACGCGTGGGGAATTTAGAACGTTCAAT
CAAATTTTATACTGAAGTATTAGGTATGCGTTTGTTACGGACTAGTGAGA
ATGAACAATATAAGTATAGTTTAGCCTTTTTAGGTTATGCCGATGAAAGT
GAAAATGCGGTGCTTGAATTAACGTATAATTGGGGAGTAGATCACTACGA
TTTAGGTAATGCTTTTGGGCATATTGCATTAGGTATTGATAATATTTATA
CCACTGTTGAAGCGGTTCGGTTAGCAGGCGGTAAAATCACGCGTGAGCCG
GGCCCGGTATTAGGCGGTAAAACAGTGATTGCTTTTGCCGAAGACCCTGA
TGGCTATAAAATTGAGTTTATCGAGAATAAAAATGCACAGGTAGCGTTAG
GTAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy