Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR424 IGR425 IGR422 IGR423 IGR421 IGR426 IGR427 IGR428 IGR429 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 dksA, - HD0603 folK, - HD0605 rnt, - HD0611 tbpA, - HD0601 pcnB, - HD0604 HD0609 fabB, - HD0612 HD0607 gloA, - HD0610 dksA, - HD0603 folK, - HD0605 rnt, - HD0611 tbpA, - HD0601 pcnB, - HD0604 fabB, - HD0612 HD0607 HD0608 HD0606 HD0606 HD0609 HD0608 gloA, - HD0610 dksA, - HD0603 folK, - HD0605 rnt, - HD0611 tbpA, - HD0601 pcnB, - HD0604 HD0602 HD0602
* Calculated from Protein Sequence

Gene ID: HD0607

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
469063

Gene Stop:
466283

Gene Length:
2781

Molecular Weight*:
105458

pI*:
10.00

Net Charge*:
23.54

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two moderate hits in gapped BLAST to a hypothetical protein in E. coli; e.g., residues 55-912 are 26% similar to residues 38-861 of YDBH_ECOLI, a hypothetical 96.8 kD protein in the ldhA-tynA intergenic region [2506661], and residues 284-912 are 27% similar to residues 4-617 of a sequence defined as ORF_ID:o265#2 [1742264].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 55-912 are 26% similar to a (LDHA-TYNA) protein domain (PD148240) which is seen in YDBH_ECOLI.



Paralogs:  Local Blast Search
HD0607 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LDFSRVACDTLSIHQCVNLMFKRSLFVIVFFTLFSISSLALLSSVHFTRV
INWLLPTGWQLNTVNSINTTLKGASLDQFSLSYQGCPLIAVDKFAIHWHS
QRRISIDNATLDYACFAKIPKTASENNTLSLNAMLALLPEGEAELKSLTW
LNIPDNIPTRLKAFFSHASYAKVTFFQDNLTAFIQQQALKLDATLTNHHL
SAKVHYQPREQEQHNLSFSSTLVDNLFEIPTAFEGHYHWRMPKEIIENDT
IREGKTTLRWTTDQQQTRVGEWLFTSVTDPTNQLQFPFTVDQQTLEIKQG
KFYLDWLSDFPLQGFINARLTPNSFTQADFYPIKTYLRVSLLSQSKTAGK
ANIVLQNNAGELHKDSVNLPLQITGNIKYNDMVLYSSLPIDFKGKFDDLT
LKFQPKSLLRLVGKERLLTIKELRFPLAGIQINKYGINGRLQALFKGESP
DFENIHFHLDGMAQHFKMGQLDFFKDAALDQSAKDQWHWKIWGSTKIKNL
ADSLKLSGRGNWHKNLVQINELTGSLGNIYQKGIAIPNTELRLLEPIKFA
YQKWYLAGRVQIKAPEINFDYGGQLLSPTATLQANGEIENLNLKGEIRAD
KIGPLKLFARRKLTQQSSTLLGRLYWKEQPANIFQSLFPFRQNWLITAGT
IRGETAFSVSAANGLVTGGHFAIRNGAISMPYGEAKGLEFNLPYRLKNNQ
LDFGLKQPINLKIAYLNVGLPITNIRAKVFGHYPYTPQQPLKLEQLSMNL
LDGALRIEHFALPQTKVAYLHLSQINFEQILALLKYQQIELKGRANATFP
FWIEGKPCYVCNGSMAQAVSSRLKIAPELMQAISQSNGYSERLLAYLLHD
TRITDLTSKVNINSEGEMALQAKLNMQLNQQAQTKINFNYHHQENVFKLW
RTLNAGTYVEQNFENSIYQKLDRTNE$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGACTTTAGCCGTGTTGCTTGCGATACTTTATCCATTCACCAATGTGT
AAACCTAATGTTTAAACGAAGCCTATTTGTTATTGTTTTTTTCACTTTAT
TTAGCATAAGCAGCCTAGCATTATTATCTAGCGTTCATTTTACGCGGGTA
ATTAATTGGCTATTGCCAACCGGTTGGCAATTAAATACAGTAAATAGCAT
TAATACCACCTTAAAAGGGGCTTCGCTTGATCAATTTTCACTATCCTATC
AAGGTTGTCCATTGATTGCAGTGGATAAATTCGCTATCCATTGGCATAGT
CAACGTCGTATTTCAATTGATAACGCAACGCTAGATTATGCCTGTTTTGC
CAAAATCCCAAAGACCGCTAGCGAAAATAACACCCTCTCGCTCAACGCTA
TGCTGGCATTATTACCCGAAGGCGAAGCAGAGCTAAAATCACTTACTTGG
CTAAATATTCCTGACAACATACCAACACGCCTCAAAGCGTTTTTTAGCCA
CGCTAGTTACGCAAAAGTTACTTTTTTTCAAGATAATTTAACCGCATTTA
TCCAACAACAAGCGCTCAAATTAGACGCTACATTAACCAACCATCATTTA
TCGGCTAAAGTGCATTATCAACCCCGTGAACAAGAACAACATAACTTGTC
TTTTTCAAGTACGCTCGTCGACAATCTATTTGAGATTCCAACTGCATTTG
AAGGCCATTATCACTGGCGAATGCCAAAAGAAATAATTGAAAATGATACT
ATTCGAGAAGGTAAAACTACACTTCGTTGGACGACTGATCAACAACAAAC
ACGTGTAGGAGAATGGTTATTCACGTCAGTTACTGATCCAACCAATCAAT
TACAGTTTCCTTTTACTGTTGACCAACAAACGCTGGAAATTAAACAAGGC
AAATTTTATCTAGATTGGTTAAGTGATTTTCCATTACAAGGTTTTATTAA
TGCAAGACTAACACCAAATAGCTTTACCCAAGCGGATTTTTATCCGATCA
AAACTTATTTACGCGTCAGCTTACTTTCTCAGAGTAAAACGGCAGGAAAA
GCCAATATTGTATTACAAAATAATGCGGGTGAATTGCATAAAGATAGCGT
AAATCTACCGCTCCAAATTACCGGCAATATCAAATATAATGATATGGTAT
TATATAGTTCTTTACCCATTGATTTTAAAGGAAAATTTGACGATTTAACA
CTCAAATTTCAACCTAAATCATTGCTACGTTTAGTGGGTAAAGAACGCTT
ATTAACGATTAAAGAATTGCGTTTTCCATTAGCGGGAATTCAGATCAATA
AATATGGCATTAATGGCCGCTTGCAAGCCTTATTCAAAGGCGAAAGCCCG
GACTTTGAAAATATTCACTTTCATCTAGATGGTATGGCACAGCATTTCAA
AATGGGACAACTCGATTTTTTCAAAGATGCTGCGCTAGATCAGTCCGCCA
AAGACCAATGGCATTGGAAAATTTGGGGATCGACTAAAATAAAAAACCTA
GCTGATAGCCTAAAACTCAGCGGACGTGGTAATTGGCATAAAAATTTAGT
GCAAATCAATGAATTGACCGGTTCGTTGGGCAATATCTATCAAAAAGGCA
TCGCCATTCCCAACACAGAATTACGTTTGCTTGAACCAATCAAGTTTGCC
TACCAAAAATGGTACTTAGCCGGTAGGGTTCAAATTAAAGCACCTGAAAT
TAATTTCGATTATGGCGGCCAACTACTTAGCCCAACCGCCACTTTACAAG
CCAATGGTGAAATAGAAAATTTAAACCTTAAAGGCGAAATTCGCGCAGAT
AAAATTGGTCCATTAAAATTATTTGCACGTCGAAAACTAACACAACAAAG
CAGTACTTTATTAGGTCGTTTATATTGGAAAGAACAGCCCGCTAATATTT
TTCAATCACTATTTCCATTTCGACAAAATTGGTTAATTACCGCAGGCACT
ATTCGTGGTGAAACGGCTTTTAGTGTCAGTGCTGCTAATGGTTTAGTCAC
CGGAGGACATTTTGCTATTCGTAATGGCGCTATTTCAATGCCATATGGGG
AAGCAAAAGGGCTTGAATTTAACTTACCTTATCGCTTGAAAAACAATCAA
TTAGACTTTGGTTTAAAACAACCTATTAATTTAAAAATTGCTTATCTAAA
TGTTGGCTTACCGATTACAAATATTCGAGCAAAAGTCTTTGGACATTATC
CTTATACGCCACAACAACCATTAAAATTAGAACAACTATCAATGAATTTA
TTAGATGGCGCTTTGCGGATAGAACATTTTGCCTTACCACAAACTAAAGT
CGCTTATCTTCATTTATCACAAATTAATTTTGAACAAATTTTAGCTTTGC
TTAAATATCAACAAATTGAGTTGAAAGGACGTGCTAATGCAACTTTTCCT
TTTTGGATTGAAGGAAAACCTTGTTATGTATGTAATGGATCAATGGCACA
AGCGGTTAGTTCTAGGCTAAAAATTGCCCCTGAATTGATGCAAGCTATTT
CACAGAGTAATGGTTATTCTGAACGTTTATTAGCATATTTGCTACACGAC
ACACGCATTACTGATTTAACTAGCAAGGTAAATATTAATTCTGAAGGCGA
AATGGCATTACAAGCCAAGTTAAATATGCAATTAAATCAACAAGCACAGA
CGAAAATTAACTTTAACTACCATCATCAAGAAAATGTATTTAAACTATGG
CGGACACTAAATGCTGGCACTTACGTTGAACAAAATTTTGAAAATTCAAT
TTATCAAAAACTGGATCGCACAAATGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy